Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2771
Gene name
LocationContig_1682:2974..4284
Strand-
Gene length (bp)1310
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 6.8E-06 118 155
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 9.2E-06 109 335

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 103 125 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2771
MGRLSRLFLARPAPDLTLVVVAAAAAATAILSLYHLCVRPALGERSTTARVRRCEAREAARLDPAAPETWPYPPH
VFPGAHDVETEVMLFDVPFDDRLYTTQILLVLVSSPLPWTGSAAFHLLGYSLGGGLAASFAAHRPHIVRSLTLVC
PGGIVRTSHVSLKSRLLYSESILPACLVNALARGRLQPRRGASADVPEGETADVDFDDVPLSTSRKAPTVGDAVG
WQLRGNSGFVGAYMSTIRHAPIHGQHEKVWRLLSQQLARRRRRGHVPESQFPPGLVGGKICLILAERDPIVIKDE
WIEESKTVLGEDGRHVFLLGGGHGIAISRGREVAAIARRA*
Coding >Hirsu2|2771
ATGGGCCGACTCTCGCGCCTCTTCCTCGCCCGACCGGCGCCGGACCTGACTCTGGTCGTCGTCGCCGCCGCCGCC
GCCGCCACCGCTATTCTTTCCCTTTACCACCTCTGCGTCCGCCCGGCGCTCGGCGAGAGGTCGACGACGGCTCGG
GTCCGGAGATGCGAGGCCCGCGAGGCGGCGCGGCTCGACCCCGCCGCCCCCGAGACCTGGCCCTACCCGCCGCAT
GTCTTCCCGGGGGCGCACGACGTCGAGACCGAGGTCATGCTGTTCGACGTCCCGTTCGATGACCGTCTCTACACA
ACCCAGATCCTGCTCGTCCTCGTCTCTTCTCCGCTCCCCTGGACCGGCTCGGCAGCCTTCCATCTGTTGGGGTAC
TCGCTGGGAGGCGGCCTCGCGGCCTCCTTCGCCGCCCATCGTCCCCATATCGTCCGCTCTCTCACTCTGGTCTGT
CCCGGCGGAATCGTGCGCACGTCCCACGTCTCACTCAAGAGCCGGCTGCTCTACTCGGAGAGCATCTTGCCGGCC
TGCCTCGTCAACGCGCTGGCGCGTGGCAGGCTGCAGCCGCGGCGCGGGGCCAGCGCCGACGTACCCGAGGGCGAG
ACCGCCGACGTCGACTTTGACGACGTGCCCTTGTCGACGAGTCGAAAAGCCCCGACGGTTGGGGACGCTGTCGGC
TGGCAGCTGCGCGGCAACAGCGGCTTCGTAGGGGCGTACATGAGCACCATCCGCCACGCGCCTATTCACGGACAG
CATGAAAAGGTCTGGAGGCTGCTCAGCCAGCAGCTGGCCCGGCGGCGGCGGCGAGGACACGTCCCTGAGAGTCAG
TTTCCTCCCGGTCTGGTTGGAGGCAAGATCTGCCTGATCCTCGCCGAGAGAGACCCCATCGTCATAAAGGACGAG
TGGATCGAGGAGTCCAAGACCGTGCTGGGCGAGGACGGACGACATGTCTTTCTTCTCGGCGGCGGCCACGGAATT
GCAATCTCCAGGGGCCGTGAGGTCGCGGCCATCGCCAGGAGAGCCTAG
Transcript >Hirsu2|2771
ATGGGCCGACTCTCGCGCCTCTTCCTCGCCCGACCGGCGCCGGACCTGACTCTGGTCGTCGTCGCCGCCGCCGCC
GCCGCCACCGCTATTCTTTCCCTTTACCACCTCTGCGTCCGCCCGGCGCTCGGCGAGAGGTCGACGACGGCTCGG
GTCCGGAGATGCGAGGCCCGCGAGGCGGCGCGGCTCGACCCCGCCGCCCCCGAGACCTGGCCCTACCCGCCGCAT
GTCTTCCCGGGGGCGCACGACGTCGAGACCGAGGTCATGCTGTTCGACGTCCCGTTCGATGACCGTCTCTACACA
ACCCAGATCCTGCTCGTCCTCGTCTCTTCTCCGCTCCCCTGGACCGGCTCGGCAGCCTTCCATCTGTTGGGGTAC
TCGCTGGGAGGCGGCCTCGCGGCCTCCTTCGCCGCCCATCGTCCCCATATCGTCCGCTCTCTCACTCTGGTCTGT
CCCGGCGGAATCGTGCGCACGTCCCACGTCTCACTCAAGAGCCGGCTGCTCTACTCGGAGAGCATCTTGCCGGCC
TGCCTCGTCAACGCGCTGGCGCGTGGCAGGCTGCAGCCGCGGCGCGGGGCCAGCGCCGACGTACCCGAGGGCGAG
ACCGCCGACGTCGACTTTGACGACGTGCCCTTGTCGACGAGTCGAAAAGCCCCGACGGTTGGGGACGCTGTCGGC
TGGCAGCTGCGCGGCAACAGCGGCTTCGTAGGGGCGTACATGAGCACCATCCGCCACGCGCCTATTCACGGACAG
CATGAAAAGGTCTGGAGGCTGCTCAGCCAGCAGCTGGCCCGGCGGCGGCGGCGAGGACACGTCCCTGAGAGTCAG
TTTCCTCCCGGTCTGGTTGGAGGCAAGATCTGCCTGATCCTCGCCGAGAGAGACCCCATCGTCATAAAGGACGAG
TGGATCGAGGAGTCCAAGACCGTGCTGGGCGAGGACGGACGACATGTCTTTCTTCTCGGCGGCGGCCACGGAATT
GCAATCTCCAGGGGCCGTGAGGTCGCGGCCATCGCCAGGAGAGCCTAG
Gene >Hirsu2|2771
ATGGGCCGACTCTCGCGCCTCTTCCTCGCCCGACCGGCGCCGGACCTGACTCTGGTCGTCGTCGCCGCCGCCGCC
GCCGCCACCGCTATTCTTTCCCTTTACCACCTCTGCGTCCGCCCGGCGCTCGGCGAGAGGTCGACGACGGCTCGG
GTCCGGAGATGCGAGGCCCGCGAGGCGGCGCGGCTCGACCCCGCCGCCCCCGAGACCTGGCCCTACCCGCCGCAT
GTCTTCCCGGGGGCGCACGACGTCGAGACCGAGTACGGGATCGTCGGGTCACGAGTGGGGCCCCAAGGACGGCGA
CATGGCTCACGAGTTCGTCGGCCGTGGCTGTAGGGTCATGCTGTTCGGTGAGCGAGCCCCTGCCTCGACGTGTCG
CTCGCTGGTGATCAGCCACAAACAAGGCTGCCTTGGTTGGCGCGTCAGTGGCCAGTTCTGGGCGTTGTCAGACTT
CCCAGATTGTTGACTGCCCCTCCTCGATGCTCCAGACGTCTGTGGCATCGATCCGCGTGGCTCACCCGGCGCAGA
CTTTCTGACAAGGCTACTCCGACGCCCCCGTAGACGTCCCGTTCGATGACCGTCTCTACACAACCCAGATCCTGC
TCGTCCTCGTCTCTTCTCCGCTCCCCTGGACCGGCTCGGCAGCCTTCCATCTGTTGGGGTACTCGCTGGGAGGCG
GCCTCGCGGCCTCCTTCGCCGCCCATCGTCCCCATATCGTCCGCTCTCTCACTCTGGTCTGTCCCGGCGGAATCG
TGCGCACGTCCCACGTCTCACTCAAGAGCCGGCTGCTCTACTCGGAGAGCATCTTGCCGGCCTGCCTCGTCAACG
CGCTGGCGCGTGGCAGGCTGCAGCCGCGGCGCGGGGCCAGCGCCGACGTACCCGAGGGCGAGACCGCCGACGTCG
ACTTTGACGACGTGCCCTTGTCGACGAGTCGAAAAGCCCCGACGGTTGGGGACGCTGTCGGCTGGCAGCTGCGCG
GCAACAGCGGCTTCGTAGGGGCGTACATGAGCACCATCCGCCACGCGCCTATTCACGGACAGCATGAAAAGGTCT
GGAGGCTGCTCAGCCAGCAGCTGGCCCGGCGGCGGCGGCGAGGACACGTCCCTGAGAGTCAGTTTCCTCCCGGTC
TGGTTGGAGGCAAGATCTGCCTGATCCTCGCCGAGAGAGACCCCATCGTCATAAAGGACGAGTGGATCGAGGAGT
CCAAGACCGTGCTGGGCGAGGACGGACGACATGTCTTTCTTCTCGGCGGCGGCCACGGAATTGCAATCTCCAGGG
GCCGTGAGGTCGCGGCCATCGCCAGGAGAGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail