Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|277
Gene name
LocationContig_1050:2126..4176
Strand-
Gene length (bp)2050
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.0E-31 114 584
PF00083 Sugar_tr Sugar (and other) transporter 3.8E-06 142 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 107 615 4.0E-38
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 92 300 2.0E-13
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 107 301 4.0E-12
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 108 261 5.0E-12
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 405 592 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25351|YCR3_YEAST Uncharacterized membrane protein YCR023C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR023C PE=1 SV=2 107 615 4.0E-38
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 92 300 2.0E-13
sp|Q94BZ1|ZIFL1_ARATH Protein ZINC INDUCED FACILITATOR-LIKE 1 OS=Arabidopsis thaliana GN=ZIFL1 PE=2 SV=1 107 301 4.0E-12
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 108 261 5.0E-12
sp|Q3EAQ5|PTR36_ARATH Probable peptide/nitrate transporter At3g43790 OS=Arabidopsis thaliana GN=ZIFL2 PE=2 SV=2 405 592 2.0E-10
sp|P51563|TCR7_VIBAN Tetracycline resistance protein, class G OS=Vibrio anguillarum GN=tetA PE=3 SV=1 122 322 6.0E-09
sp|P02980|TCR2_ECOLX Tetracycline resistance protein, class B OS=Escherichia coli GN=tetA PE=1 SV=1 118 296 4.0E-07
sp|P02982|TCR1_ECOLX Tetracycline resistance protein, class A OS=Escherichia coli GN=tetA PE=3 SV=2 108 263 4.0E-07
sp|P33733|TCR4_SALOR Tetracycline resistance protein, class D OS=Salmonella ordonez GN=tetA PE=3 SV=1 118 307 8.0E-07
sp|Q9D2V8|MFS10_MOUSE Major facilitator superfamily domain-containing protein 10 OS=Mus musculus GN=Mfsd10 PE=1 SV=1 138 267 4.0E-06
sp|Q8RWN2|ZIF1_ARATH Protein ZINC INDUCED FACILITATOR 1 OS=Arabidopsis thaliana GN=ZIF1 PE=1 SV=2 380 594 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 150 172 22
2 182 204 22
3 239 261 22
4 271 293 22
5 425 447 22
6 462 484 22
7 491 513 22
8 533 555 22
9 603 625 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|277
MPQAKSRSGGAPQRPGLAPPLPSAGRTVSSGSFHAGAPIPTLAGLRRASTYRYQTFPTQPPLPPPAERPDDGSCS
DSACSSSSPPPSSPSSTPSSTPSSSTSEQTPLPVRQLLLLAFLSLSEQTALNSISPYLPRMVASMPGVPAGQSGL
YVGILASAFALAQLSTNFLWGYASDVVGRKPVLLAGTSALTCCFCVFGLCRLYWQAVVVHVAMGLLNGNAACVPT
VLGEVTDRSNQSKAFTYLPVIYSLGGITGPALGGLLVGRLGPDYPYLGPNVLAAAMLATSVAAVALWFDETLDDQ
SGPGPWKPRWIARLSAWLRRRGNPRAHRNSWSSRWPYRQAAGNNNDGNDNNQQQQQRRPLLAPEAASVADDDYDD
YDDDDDEDTDDSHSPSDAHGHAASAASKAGPDEERPPVWRDLLNGTTITLLTTYLVFQLSNISFNSLYPIFASAP
APTGRELSPGRIGVSLSLAGLATIIFQAFLYQPLKARTGSLGAYRLSLLGIAVSMALIPWVGYLDDDPPLGLGTG
RLWLYLELGIVLVLKNICAVSGLSSVMLLITNSAPSHASLGTLNGVAQTLSALGRSFGPFVSGGLFTLSINVRPK
GEALAWSVFGGLALLGWLGSMFIRGNGLESEDWDDDGDGDYREHDSV*
Coding >Hirsu2|277
ATGCCCCAGGCCAAGTCGCGCTCCGGCGGCGCCCCGCAGCGCCCCGGCCTTGCGCCGCCGCTGCCGTCCGCCGGC
CGCACCGTCTCGTCCGGGTCTTTCCATGCCGGGGCGCCAATCCCGACCCTGGCCGGCCTGCGCCGCGCCTCGACC
TACCGCTACCAGACGTTCCCCACGCAGCCGCCCCTGCCGCCGCCCGCGGAGCGGCCCGACGACGGCTCCTGTTCG
GACTCGGCCTGTTCTTCTTCCTCTCCTCCCCCGTCGTCGCCCTCGTCGACGCCCTCGTCGACGCCCTCGTCGTCT
ACTAGCGAACAGACGCCCTTGCCAGTGCGGCAACTCCTCCTCCTGGCCTTCCTGTCGCTCTCGGAGCAGACGGCG
CTCAACTCCATCTCGCCCTACCTGCCGCGCATGGTGGCGTCTATGCCCGGCGTGCCGGCCGGCCAGAGCGGTCTG
TACGTCGGCATACTGGCCAGCGCCTTCGCCCTGGCGCAGCTGTCGACAAACTTCCTCTGGGGCTACGCCTCGGAC
GTCGTCGGCCGCAAGCCTGTCCTCCTGGCTGGCACCTCGGCCCTCACCTGCTGCTTCTGCGTCTTCGGCCTGTGC
CGCCTGTACTGGCAGGCCGTCGTCGTCCACGTCGCCATGGGCCTGCTTAACGGCAACGCCGCCTGCGTGCCCACC
GTTCTGGGCGAGGTCACCGACCGTTCCAACCAGAGCAAGGCCTTCACCTACCTGCCCGTCATCTACTCCCTCGGC
GGCATCACCGGGCCGGCCCTGGGCGGCCTGCTCGTTGGCCGCCTGGGGCCCGACTACCCCTACTTGGGGCCCAAC
GTCCTCGCCGCCGCCATGCTGGCCACCAGCGTCGCCGCCGTCGCCCTCTGGTTCGACGAGACGCTCGATGACCAG
TCCGGCCCGGGCCCCTGGAAGCCGCGCTGGATTGCTCGCCTGTCCGCCTGGCTACGCCGCCGAGGAAACCCGAGG
GCTCATCGGAACTCATGGAGCTCGCGTTGGCCGTACCGTCAGGCTGCCGGCAACAACAACGATGGCAATGACAAC
AACCAGCAGCAGCAACAGCGGCGGCCCTTGCTCGCGCCTGAGGCCGCCTCCGTCGCCGACGACGACTATGACGAC
TACGACGACGACGACGACGAAGACACCGACGACAGCCACAGTCCCTCCGACGCGCACGGCCACGCCGCCTCCGCC
GCCTCCAAGGCAGGGCCTGATGAAGAGCGGCCGCCGGTCTGGCGCGACCTCCTCAACGGTACCACCATCACCCTG
CTCACCACCTACCTCGTCTTTCAGCTGTCCAACATCAGCTTCAACAGCCTGTACCCCATCTTCGCCTCGGCGCCC
GCCCCGACCGGCCGCGAGCTGAGCCCCGGCCGGATCGGCGTCAGCCTAAGCCTGGCCGGCCTGGCCACCATCATC
TTCCAGGCCTTCCTCTACCAGCCGCTCAAGGCCAGGACCGGTAGTCTGGGCGCCTACCGCCTGTCCCTGCTAGGT
ATCGCCGTCAGCATGGCCCTCATCCCCTGGGTCGGCTATCTAGACGACGACCCGCCCCTGGGCCTCGGCACCGGC
CGCCTCTGGCTCTACCTTGAGCTCGGCATCGTGCTCGTCCTCAAGAACATCTGCGCCGTCAGCGGTCTGTCCAGC
GTTATGCTCCTGATCACCAACTCGGCGCCCTCGCACGCAAGCCTCGGGACCCTGAACGGCGTGGCCCAGACGCTC
TCAGCCTTGGGTCGCAGCTTTGGGCCCTTCGTCTCCGGTGGCCTCTTCACCCTCTCCATCAACGTGCGGCCCAAG
GGTGAAGCCCTCGCCTGGAGCGTCTTCGGCGGCCTGGCCCTCCTCGGCTGGCTCGGCTCCATGTTCATCCGCGGC
AACGGCCTGGAGAGCGAGGACTGGGACGACGACGGCGACGGCGACTACCGCGAGCACGACTCTGTTTGA
Transcript >Hirsu2|277
ATGCCCCAGGCCAAGTCGCGCTCCGGCGGCGCCCCGCAGCGCCCCGGCCTTGCGCCGCCGCTGCCGTCCGCCGGC
CGCACCGTCTCGTCCGGGTCTTTCCATGCCGGGGCGCCAATCCCGACCCTGGCCGGCCTGCGCCGCGCCTCGACC
TACCGCTACCAGACGTTCCCCACGCAGCCGCCCCTGCCGCCGCCCGCGGAGCGGCCCGACGACGGCTCCTGTTCG
GACTCGGCCTGTTCTTCTTCCTCTCCTCCCCCGTCGTCGCCCTCGTCGACGCCCTCGTCGACGCCCTCGTCGTCT
ACTAGCGAACAGACGCCCTTGCCAGTGCGGCAACTCCTCCTCCTGGCCTTCCTGTCGCTCTCGGAGCAGACGGCG
CTCAACTCCATCTCGCCCTACCTGCCGCGCATGGTGGCGTCTATGCCCGGCGTGCCGGCCGGCCAGAGCGGTCTG
TACGTCGGCATACTGGCCAGCGCCTTCGCCCTGGCGCAGCTGTCGACAAACTTCCTCTGGGGCTACGCCTCGGAC
GTCGTCGGCCGCAAGCCTGTCCTCCTGGCTGGCACCTCGGCCCTCACCTGCTGCTTCTGCGTCTTCGGCCTGTGC
CGCCTGTACTGGCAGGCCGTCGTCGTCCACGTCGCCATGGGCCTGCTTAACGGCAACGCCGCCTGCGTGCCCACC
GTTCTGGGCGAGGTCACCGACCGTTCCAACCAGAGCAAGGCCTTCACCTACCTGCCCGTCATCTACTCCCTCGGC
GGCATCACCGGGCCGGCCCTGGGCGGCCTGCTCGTTGGCCGCCTGGGGCCCGACTACCCCTACTTGGGGCCCAAC
GTCCTCGCCGCCGCCATGCTGGCCACCAGCGTCGCCGCCGTCGCCCTCTGGTTCGACGAGACGCTCGATGACCAG
TCCGGCCCGGGCCCCTGGAAGCCGCGCTGGATTGCTCGCCTGTCCGCCTGGCTACGCCGCCGAGGAAACCCGAGG
GCTCATCGGAACTCATGGAGCTCGCGTTGGCCGTACCGTCAGGCTGCCGGCAACAACAACGATGGCAATGACAAC
AACCAGCAGCAGCAACAGCGGCGGCCCTTGCTCGCGCCTGAGGCCGCCTCCGTCGCCGACGACGACTATGACGAC
TACGACGACGACGACGACGAAGACACCGACGACAGCCACAGTCCCTCCGACGCGCACGGCCACGCCGCCTCCGCC
GCCTCCAAGGCAGGGCCTGATGAAGAGCGGCCGCCGGTCTGGCGCGACCTCCTCAACGGTACCACCATCACCCTG
CTCACCACCTACCTCGTCTTTCAGCTGTCCAACATCAGCTTCAACAGCCTGTACCCCATCTTCGCCTCGGCGCCC
GCCCCGACCGGCCGCGAGCTGAGCCCCGGCCGGATCGGCGTCAGCCTAAGCCTGGCCGGCCTGGCCACCATCATC
TTCCAGGCCTTCCTCTACCAGCCGCTCAAGGCCAGGACCGGTAGTCTGGGCGCCTACCGCCTGTCCCTGCTAGGT
ATCGCCGTCAGCATGGCCCTCATCCCCTGGGTCGGCTATCTAGACGACGACCCGCCCCTGGGCCTCGGCACCGGC
CGCCTCTGGCTCTACCTTGAGCTCGGCATCGTGCTCGTCCTCAAGAACATCTGCGCCGTCAGCGGTCTGTCCAGC
GTTATGCTCCTGATCACCAACTCGGCGCCCTCGCACGCAAGCCTCGGGACCCTGAACGGCGTGGCCCAGACGCTC
TCAGCCTTGGGTCGCAGCTTTGGGCCCTTCGTCTCCGGTGGCCTCTTCACCCTCTCCATCAACGTGCGGCCCAAG
GGTGAAGCCCTCGCCTGGAGCGTCTTCGGCGGCCTGGCCCTCCTCGGCTGGCTCGGCTCCATGTTCATCCGCGGC
AACGGCCTGGAGAGCGAGGACTGGGACGACGACGGCGACGGCGACTACCGCGAGCACGACTCTGTTTGA
Gene >Hirsu2|277
ATGCCCCAGGCCAAGTCGCGCTCCGGCGGCGCCCCGCAGCGCCCCGGCCTTGCGCCGCCGCTGCCGTCCGCCGGC
CGCACCGTCTCGTCCGGGTCTTTCCATGCCGGGGCGCCAATCCCGACCCTGGCCGGCCTGCGCCGCGCCTCGACC
TACCGCTACCAGACGTTCCCCACGCAGCCGCCCCTGCCGCCGCCCGCGGAGCGGCCCGACGACGGCTCCTGTTCG
GACTCGGCCTGTTCTTCTTCCTCTCCTCCCCCGTCGTCGCCCTCGTCGACGCCCTCGTCGACGCCCTCGTCGTCT
ACTAGCGAACAGACGCCCTTGCCAGTGCGGCAACTCCTCCTCCTGGCCTTCCTGTCGCTCTCGGAGCAGACGGCG
CTCAACTCCATCTCGCCCTACCTGCCGCGCATGGTGGCGTCTATGCCCGGCGTGCCGGCCGGCCAGAGCGGTCTG
TACGTCGGCATACTGGCCAGCGCCTTCGCCCTGGCGCAGCTGTCGACAAACTTCCTCTGGGGCTACGCCTCGGAC
GTCGTCGGCCGCAAGCCTGTCCTCCTGGCTGGCACCTCGGCCCTCACCTGCTGCTTCTGCGTCTTCGGCCTGTGC
CGCCTGTACTGGCAGGCCGTCGTCGTCCACGTCGCCATGGGCCTGCTTAACGGCAACGCCGCCTGCGTGCCCACC
GTTCTGGGCGAGGTCACCGACCGTTCCAACCAGAGCAAGGCCTTCACCTACCTGCCCGTCATCTACTCCCTCGGC
GGCATCACCGGGCCGGCCCTGGGCGGCCTGCTCGTTGGCCGCCTGGGGCCCGACTACCCCTACTTGGGGCCCAAC
GTCCTCGCCGCCGCCATGCTGGCCACCAGCGTCGCCGCCGTCGCCCTCTGGTTCGACGAGACGCTCGATGACCAG
TCCGGCCCGGGCCCCTGGAAGCCGCGCTGGATTGCTCGCCTGTCCGCCTGGCTACGCCGCCGAGGAAACCCGAGG
GCTCATCGGAACTCATGGAGCTCGCGTTGGCCGTACCGTCAGGCTGCCGGCAACAACAACGATGGCAATGACAAC
AACCAGCAGCAGCAACAGCGGCGGCCCTTGCTCGCGCCTGAGGCCGCCTCCGTCGCCGACGACGACTATGACGAC
TACGACGACGACGACGACGAAGACACCGACGACAGCCACAGTCCCTCCGACGCGCACGGCCACGCCGCCTCCGCC
GCCTCCAAGGCAGGGCCTGATGAAGAGCGGCCGCCGGTCTGGCGCGACCTCCTCAACGGTACCACCATCACCCTG
CTCACCACCTACCTCGTCTTTCAGCTGTCCAACATCAGCTTCAACAGCCTGTACCCCATCTTCGCCTCGGCGCCC
GCCCCGACCGGCCGCGAGCTGAGCCCCGGCCGGATCGGCGTCAGCCTAAGCCTGGCCGGCCTGGCCACCATCATC
TTCCAGGCCTTCCTCTACCAGCCGCTCAAGGCCAGGACCGGTAGTCTGGGCGCCTACCGCCTGTCCCTGCTAGGT
ATCGCCGTCAGCATGGCCCTCATCCCCTGGGTCGGCTATCTAGACGACGACCCGCCCCTGGGCCTCGGCACCGGC
CGCCTCTGGCTCTACCTTGAGCTCGGCATCGTGCTCGTCCTCAAGAACATCTGCGCCGTCAGCGGTCTGTCCAGC
GTTATGCTCCTGGTACGTTCAATCCCGCTCTGTGCCCCCGACCCCCGACCCCCGCCCCTACCTTCACGGCAACGA
TCGCCGCGCCACGAGACGTATGTGCGGCTGACGCGCTTTTCAGATCACCAACTCGGCGCCCTCGCACGCAAGCCT
CGGGACCCTGAACGGCGTGGCCCAGACGCTCTCAGCCTTGGGTCGCAGCTTTGGGCCCTTCGTCTCCGGTGGCCT
CTTCACCCTCTCCATCAACGTGCGGCCCAAGGGTGAAGCCCTCGCCTGGAGCGTCTTCGGCGGCCTGGCCCTCCT
CGGCTGGCTCGGCTCCATGTTCATCCGCGGCAACGGCCTGGAGAGCGAGGACTGGGACGACGACGGCGACGGCGA
CTACCGCGAGCACGACTCTGTTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail