Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2769
Gene name
LocationContig_1682:382..1037
Strand-
Gene length (bp)655
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13499 EF-hand_7 EF-hand domain pair 4.8E-10 23 87
PF13499 EF-hand_7 EF-hand domain pair 1.4E-12 92 149
PF00036 EF-hand_1 EF hand 8.4E-08 63 88
PF13202 EF-hand_5 EF hand 1.3E-06 63 87
PF13202 EF-hand_5 EF hand 4.5E-05 97 116
PF13202 EF-hand_5 EF hand 3.3E-05 132 151
PF13405 EF-hand_6 EF-hand domain 4.7E-07 94 120
PF13833 EF-hand_8 EF-hand domain pair 1.1E-03 66 88
PF10591 SPARC_Ca_bdg Secreted protein acidic and rich in cysteine Ca binding region 2.3E-04 88 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 20 151 4.0E-17
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 20 151 2.0E-16
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 23 151 4.0E-16
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 20 151 6.0E-16
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 23 151 8.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XH95|SCMC2_XENTR Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus tropicalis GN=slc25a25 PE=2 SV=1 20 151 4.0E-17
sp|Q7ZYD5|SCMC2_XENLA Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Xenopus laevis GN=slc25a25 PE=2 SV=1 20 151 2.0E-16
sp|O18757|SCMC1_RABIT Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Oryctolagus cuniculus GN=SLC25A24 PE=1 SV=1 23 151 4.0E-16
sp|Q6NUK1|SCMC1_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens GN=SLC25A24 PE=1 SV=2 20 151 6.0E-16
sp|A5PJZ1|SCMC1_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Bos taurus GN=SLC25A24 PE=2 SV=1 23 151 8.0E-16
sp|Q8BMD8|SCMC1_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Mus musculus GN=Slc25a24 PE=1 SV=1 23 151 1.0E-14
sp|Q7ZY36|SCM1A_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-A OS=Xenopus laevis GN=slc25a24-a PE=2 SV=2 23 151 3.0E-14
sp|Q7T0U6|SCM1B_XENLA Calcium-binding mitochondrial carrier protein SCaMC-1-B OS=Xenopus laevis GN=slc25a24-b PE=2 SV=1 23 151 5.0E-14
sp|Q6GQS1|SCMC3_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Mus musculus GN=Slc25a23 PE=1 SV=1 15 151 7.0E-14
sp|B0G159|MCFC_DICDI Mitochondrial substrate carrier family protein C OS=Dictyostelium discoideum GN=mcfC PE=2 SV=1 19 151 7.0E-14
sp|Q5XHA0|SCMC1_XENTR Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Xenopus tropicalis GN=slc25a24 PE=2 SV=1 23 151 2.0E-13
sp|Q9BV35|SCMC3_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-3 OS=Homo sapiens GN=SLC25A23 PE=1 SV=2 20 151 4.0E-13
sp|P0CI40|CMC1_YEASX Calcium-binding mitochondrial carrier SAL1 OS=Saccharomyces cerevisiae GN=SAL1 PE=3 SV=1 16 150 8.0E-13
sp|Q66L49|SCMC1_DANRE Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Danio rerio GN=slc25a24 PE=2 SV=1 3 151 8.0E-13
sp|D6W196|CMC1_YEAST Truncated non-functional calcium-binding mitochondrial carrier SAL1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAL1 PE=1 SV=2 16 150 9.0E-13
sp|A2ASZ8|SCMC2_MOUSE Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Mus musculus GN=Slc25a25 PE=1 SV=1 64 151 9.0E-13
sp|Q8K3P6|SCMC2_RAT Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Rattus norvegicus GN=Slc25a25 PE=1 SV=1 64 151 1.0E-12
sp|Q6KCM7|SCMC2_HUMAN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Homo sapiens GN=SLC25A25 PE=1 SV=1 64 151 1.0E-12
sp|Q0V7M4|SCMC2_BOVIN Calcium-binding mitochondrial carrier protein SCaMC-2 OS=Bos taurus GN=SLC25A25 PE=2 SV=1 64 151 1.0E-12
sp|A2CEQ0|SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio GN=slc25a25b PE=3 SV=2 64 151 1.0E-11
sp|P81660|TNNC2_ANGAN Troponin C, skeletal muscle OS=Anguilla anguilla PE=1 SV=1 61 150 2.0E-11
sp|P02586|TNNC2_RABIT Troponin C, skeletal muscle OS=Oryctolagus cuniculus GN=TNNC2 PE=1 SV=2 32 150 3.0E-11
sp|P02585|TNNC2_HUMAN Troponin C, skeletal muscle OS=Homo sapiens GN=TNNC2 PE=1 SV=2 32 150 5.0E-11
sp|P20801|TNNC2_MOUSE Troponin C, skeletal muscle OS=Mus musculus GN=Tnnc2 PE=1 SV=2 32 150 5.0E-11
sp|P10246|TNNC2_MELGA Troponin C, skeletal muscle OS=Meleagris gallopavo GN=TNNC2 PE=1 SV=2 32 150 5.0E-11
sp|P02589|TNNC2_PELES Troponin C, skeletal muscle OS=Pelophylax esculentus PE=1 SV=1 32 150 6.0E-11
sp|P02588|TNNC2_CHICK Troponin C, skeletal muscle OS=Gallus gallus GN=TNNC2 PE=1 SV=3 32 150 8.0E-11
sp|P02587|TNNC2_PIG Troponin C, skeletal muscle OS=Sus scrofa GN=TNNC2 PE=1 SV=2 32 150 9.0E-11
sp|Q07167|SM16_SCHMA 16 kDa calcium-binding protein OS=Schistosoma mansoni PE=2 SV=1 65 149 2.0E-10
sp|P63317|TNNC1_PIG Troponin C, slow skeletal and cardiac muscles OS=Sus scrofa GN=TNNC1 PE=1 SV=1 61 150 6.0E-10
sp|P63315|TNNC1_BOVIN Troponin C, slow skeletal and cardiac muscles OS=Bos taurus GN=TNNC1 PE=1 SV=1 61 150 6.0E-10
sp|P19123|TNNC1_MOUSE Troponin C, slow skeletal and cardiac muscles OS=Mus musculus GN=Tnnc1 PE=1 SV=1 61 150 7.0E-10
sp|P09860|TNNC1_CHICK Troponin C, slow skeletal and cardiac muscles OS=Gallus gallus GN=TNNC1 PE=1 SV=1 61 150 8.0E-10
sp|P02591|TNNC1_RABIT Troponin C, slow skeletal and cardiac muscles OS=Oryctolagus cuniculus GN=TNNC1 PE=1 SV=1 61 150 8.0E-10
sp|P63316|TNNC1_HUMAN Troponin C, slow skeletal and cardiac muscles OS=Homo sapiens GN=TNNC1 PE=1 SV=1 61 150 8.0E-10
sp|Q9LI84|CML16_ARATH Probable calcium-binding protein CML16 OS=Arabidopsis thaliana GN=CML16 PE=2 SV=2 24 150 1.0E-09
sp|Q9NZT1|CALL5_HUMAN Calmodulin-like protein 5 OS=Homo sapiens GN=CALML5 PE=1 SV=2 15 150 3.0E-09
sp|Q6NYZ6|SCM2A_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-A OS=Danio rerio GN=slc25a25a PE=2 SV=1 64 151 4.0E-09
sp|Q9JM83|CALM4_MOUSE Calmodulin-4 OS=Mus musculus GN=Calm4 PE=2 SV=2 29 150 5.0E-09
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 12 150 5.0E-09
sp|Q09665|TNNC2_CAEEL Troponin C, isoform 2 OS=Caenorhabditis elegans GN=tnc-2 PE=2 SV=1 63 150 6.0E-09
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 28 150 6.0E-09
sp|Q9M101|CDPKN_ARATH Calcium-dependent protein kinase 23 OS=Arabidopsis thaliana GN=CPK23 PE=1 SV=1 25 151 7.0E-09
sp|P05936|TNNC1_COTJA Troponin C, slow skeletal and cardiac muscles OS=Coturnix coturnix japonica GN=TNNC1 PE=2 SV=1 61 150 1.0E-08
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 28 150 1.0E-08
sp|P80322|TNNC_BRALA Troponin C OS=Branchiostoma lanceolatum PE=1 SV=1 32 151 2.0E-08
sp|Q8RZB5|CML10_ORYSJ Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica GN=CML10 PE=2 SV=1 8 151 2.0E-08
sp|P06706|TNNC_HALRO Troponin C, body wall muscle OS=Halocynthia roretzi PE=1 SV=2 63 150 3.0E-08
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 19 150 4.0E-08
sp|Q9FZ75|CML15_ARATH Probable calcium-binding protein CML15 OS=Arabidopsis thaliana GN=CML15 PE=2 SV=1 24 150 4.0E-08
sp|P02599|CALM_DICDI Calmodulin OS=Dictyostelium discoideum GN=calA PE=1 SV=3 38 150 4.0E-08
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 27 150 5.0E-08
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 27 150 5.0E-08
sp|Q9SIQ7|CDPKO_ARATH Calcium-dependent protein kinase 24 OS=Arabidopsis thaliana GN=CPK24 PE=2 SV=1 18 151 5.0E-08
sp|Q7F0J0|CML13_ORYSJ Probable calcium-binding protein CML13 OS=Oryza sativa subsp. japonica GN=CML13 PE=2 SV=1 20 150 5.0E-08
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 25 150 5.0E-08
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 25 150 6.0E-08
sp|Q9ZSA3|CDPKM_ARATH Calcium-dependent protein kinase 22 OS=Arabidopsis thaliana GN=CPK22 PE=3 SV=2 25 150 7.0E-08
sp|Q38872|CDPK6_ARATH Calcium-dependent protein kinase 6 OS=Arabidopsis thaliana GN=CPK6 PE=1 SV=1 28 150 9.0E-08
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 14 150 1.0E-07
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 14 150 1.0E-07
sp|P05434|CATR_CHLRE Caltractin OS=Chlamydomonas reinhardtii PE=1 SV=1 13 150 1.0E-07
sp|Q6L4D4|CML15_ORYSJ Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica GN=CML15 PE=2 SV=1 35 151 2.0E-07
sp|P09485|LPS1A_LYTPI Calcium-binding protein LPS1-alpha OS=Lytechinus pictus PE=2 SV=2 56 150 3.0E-07
sp|Q9LE22|CML27_ARATH Probable calcium-binding protein CML27 OS=Arabidopsis thaliana GN=CML27 PE=1 SV=1 35 151 3.0E-07
sp|P05933|CALM_SCHPO Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cam1 PE=1 SV=1 63 150 3.0E-07
sp|Q9M7R0|ALL8_OLEEU Calcium-binding allergen Ole e 8 OS=Olea europaea PE=1 SV=1 61 151 3.0E-07
sp|P23286|CALM_CANAX Calmodulin OS=Candida albicans GN=CMD1 PE=3 SV=2 63 150 3.0E-07
sp|Q9SZM3|CDPKQ_ARATH Calcium-dependent protein kinase 26 OS=Arabidopsis thaliana GN=CPK26 PE=2 SV=1 12 150 3.0E-07
sp|O64943|POLC2_JUNOX Polcalcin Jun o 2 OS=Juniperus oxycedrus PE=1 SV=2 24 151 3.0E-07
sp|Q0DJV6|CML18_ORYSJ Probable calcium-binding protein CML18 OS=Oryza sativa subsp. japonica GN=CML18 PE=2 SV=1 23 150 3.0E-07
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 49 151 5.0E-07
sp|O35648|CETN3_MOUSE Centrin-3 OS=Mus musculus GN=Cetn3 PE=1 SV=1 12 150 5.0E-07
sp|O15182|CETN3_HUMAN Centrin-3 OS=Homo sapiens GN=CETN3 PE=1 SV=2 12 150 5.0E-07
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 25 150 5.0E-07
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 25 150 6.0E-07
sp|Q38870|CDPK2_ARATH Calcium-dependent protein kinase 2 OS=Arabidopsis thaliana GN=CPK2 PE=1 SV=1 12 150 6.0E-07
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 25 150 7.0E-07
sp|Q8X187|CALM_PAXIN Calmodulin OS=Paxillus involutus GN=calA PE=2 SV=3 63 150 8.0E-07
sp|O96102|CALM_PHYPO Calmodulin OS=Physarum polycephalum PE=2 SV=3 38 150 8.0E-07
sp|Q9M8U1|CML18_ARATH Probable calcium-binding protein CML18 OS=Arabidopsis thaliana GN=CML18 PE=1 SV=1 57 150 8.0E-07
sp|O23184|CML19_ARATH Calcium-binding protein CML19 OS=Arabidopsis thaliana GN=CML19 PE=1 SV=1 86 150 1.0E-06
sp|Q84MN0|CML4_ORYSJ Calmodulin-like protein 4 OS=Oryza sativa subsp. japonica GN=CML4 PE=2 SV=1 56 150 1.0E-06
sp|Q2TBN3|CETN2_BOVIN Centrin-2 OS=Bos taurus GN=CETN2 PE=2 SV=1 14 150 1.0E-06
sp|Q9S9V0|CDPKV_ARATH Calcium-dependent protein kinase 31 OS=Arabidopsis thaliana GN=CPK31 PE=2 SV=2 25 151 1.0E-06
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 17 150 1.0E-06
sp|O97341|CALM_SUBDO Calmodulin OS=Suberites domuncula PE=2 SV=3 38 150 1.0E-06
sp|P24044|CALM_PLAFA Calmodulin OS=Plasmodium falciparum PE=3 SV=4 23 150 1.0E-06
sp|P62203|CALM_PLAF7 Calmodulin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0323 PE=3 SV=2 23 150 1.0E-06
sp|P41208|CETN2_HUMAN Centrin-2 OS=Homo sapiens GN=CETN2 PE=1 SV=1 14 150 1.0E-06
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 25 150 1.0E-06
sp|P07463|CALM_PARTE Calmodulin OS=Paramecium tetraurelia GN=CAM PE=1 SV=3 29 150 2.0E-06
sp|P02597|CALMS_CHICK Calmodulin, striated muscle OS=Gallus gallus GN=CCM1 PE=3 SV=2 63 150 2.0E-06
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 55 150 2.0E-06
sp|Q9R1K9|CETN2_MOUSE Centrin-2 OS=Mus musculus GN=Cetn2 PE=1 SV=1 14 150 2.0E-06
sp|Q9AWK2|CML11_ORYSJ Probable calcium-binding protein CML11 OS=Oryza sativa subsp. japonica GN=CML11 PE=2 SV=1 36 150 2.0E-06
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 25 150 2.0E-06
sp|P84339|CALM_AGABI Calmodulin OS=Agaricus bisporus PE=1 SV=2 23 150 2.0E-06
sp|P47947|TNNC1_DROME Troponin C, isoform 1 OS=Drosophila melanogaster GN=TpnC41C PE=2 SV=2 33 150 2.0E-06
sp|O95843|GUC1C_HUMAN Guanylyl cyclase-activating protein 3 OS=Homo sapiens GN=GUCA1C PE=1 SV=3 59 150 2.0E-06
sp|Q9ZSA4|CDPKR_ARATH Calcium-dependent protein kinase 27 OS=Arabidopsis thaliana GN=CPK27 PE=1 SV=3 25 151 2.0E-06
sp|O94739|CALM_PLEOS Calmodulin OS=Pleurotus ostreatus GN=CMD1 PE=2 SV=3 23 150 3.0E-06
sp|Q03975|LPS1B_LYTPI Calcium-binding protein LPS1-beta (Fragment) OS=Lytechinus pictus PE=2 SV=2 56 150 3.0E-06
sp|Q9FYK2|CML25_ARATH Probable calcium-binding protein CML25 OS=Arabidopsis thaliana GN=CML25 PE=2 SV=1 25 151 3.0E-06
sp|P11120|CALM_PLECO Calmodulin OS=Pleurotus cornucopiae GN=CMD1 PE=1 SV=2 23 150 3.0E-06
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 27 150 3.0E-06
sp|A5A7I7|CDPK4_SOLTU Calcium-dependent protein kinase 4 OS=Solanum tuberosum GN=CPK4 PE=2 SV=1 3 150 3.0E-06
sp|O23320|CML8_ARATH Calmodulin-like protein 8 OS=Arabidopsis thaliana GN=CML8 PE=2 SV=1 29 150 3.0E-06
sp|P02598|CALM_TETPY Calmodulin OS=Tetrahymena pyriformis PE=1 SV=4 63 150 3.0E-06
sp|Q9XZP2|CALM2_BRAFL Calmodulin-2 OS=Branchiostoma floridae GN=CAM2 PE=2 SV=4 63 150 3.0E-06
sp|P27166|CALM_STYLE Calmodulin OS=Stylonychia lemnae PE=3 SV=2 63 150 4.0E-06
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 25 150 4.0E-06
sp|P25071|CML12_ARATH Calmodulin-like protein 12 OS=Arabidopsis thaliana GN=CML12 PE=1 SV=3 63 150 4.0E-06
sp|P41210|CATR_ATRNU Caltractin OS=Atriplex nummularia PE=2 SV=1 20 150 4.0E-06
sp|P11121|CALM_PYUSP Calmodulin OS=Pyuridae sp. PE=1 SV=2 63 150 4.0E-06
sp|Q0IUU4|CML2_ORYSJ Putative calmodulin-like protein 2 OS=Oryza sativa subsp. japonica GN=CML2 PE=3 SV=2 63 150 4.0E-06
sp|Q71UH5|CALM_PYTSP Calmodulin OS=Pythium splendens PE=2 SV=1 63 150 4.0E-06
sp|P27165|CALM_PHYIN Calmodulin OS=Phytophthora infestans GN=CMD1 PE=3 SV=2 63 150 4.0E-06
sp|P41209|CETN1_MOUSE Centrin-1 OS=Mus musculus GN=Cetn1 PE=1 SV=1 14 150 4.0E-06
sp|Q40302|CALM_MACPY Calmodulin OS=Macrocystis pyrifera PE=2 SV=3 63 150 4.0E-06
sp|Q38871|CDPK5_ARATH Calcium-dependent protein kinase 5 OS=Arabidopsis thaliana GN=CPK5 PE=2 SV=1 27 150 5.0E-06
sp|Q32LE3|CETN1_BOVIN Centrin-1 OS=Bos taurus GN=CETN1 PE=2 SV=1 14 150 5.0E-06
sp|P14533|CABO_DORPE Squidulin OS=Doryteuthis pealeii PE=1 SV=1 59 150 5.0E-06
sp|Q9S744|CML9_ARATH Calmodulin-like protein 9 OS=Arabidopsis thaliana GN=CML9 PE=1 SV=1 61 150 5.0E-06
sp|P02594|CALM_ELEEL Calmodulin OS=Electrophorus electricus GN=calm PE=2 SV=2 63 150 5.0E-06
sp|P15094|CALM_ACHKL Calmodulin OS=Achlya klebsiana GN=CMD1 PE=3 SV=3 38 150 6.0E-06
sp|A8CEP3|CALM_SACJA Calmodulin OS=Saccharina japonica GN=cam PE=2 SV=1 63 150 6.0E-06
sp|P62150|CALM_ORYLA Calmodulin-A (Fragment) OS=Oryzias latipes GN=calm1 PE=2 SV=1 63 150 6.0E-06
sp|Q6L5F4|CML14_ORYSJ Probable calcium-binding protein CML14 OS=Oryza sativa subsp. japonica GN=CML14 PE=2 SV=1 66 150 7.0E-06
sp|P62146|CALMA_ARBPU Calmodulin-alpha (Fragment) OS=Arbacia punctulata PE=1 SV=2 63 150 7.0E-06
sp|Q7T3T2|CALM_EPIAK Calmodulin OS=Epinephelus akaara GN=calm PE=2 SV=3 38 150 7.0E-06
sp|P54213|CATR_DUNSA Caltractin OS=Dunaliella salina PE=2 SV=1 13 150 8.0E-06
sp|P21251|CALM_STIJA Calmodulin OS=Stichopus japonicus PE=1 SV=2 38 150 8.0E-06
sp|P62155|CALM_XENLA Calmodulin OS=Xenopus laevis GN=calm1 PE=1 SV=2 63 150 8.0E-06
sp|P62151|CALM_TORCA Calmodulin OS=Torpedo californica PE=1 SV=2 63 150 8.0E-06
sp|Q6YNX6|CALM_SHEEP Calmodulin OS=Ovis aries GN=CALM2 PE=2 SV=3 63 150 8.0E-06
sp|P62161|CALM_RAT Calmodulin OS=Rattus norvegicus GN=Calm1 PE=1 SV=2 63 150 8.0E-06
sp|P62160|CALM_RABIT Calmodulin OS=Oryctolagus cuniculus GN=CALM PE=1 SV=2 63 150 8.0E-06
sp|Q5RAD2|CALM_PONAB Calmodulin OS=Pongo abelii GN=CALM PE=2 SV=3 63 150 8.0E-06
sp|Q71UH6|CALM_PERFV Calmodulin OS=Perca flavescens GN=calm PE=2 SV=3 63 150 8.0E-06
sp|P62156|CALM_ONCSP Calmodulin OS=Oncorhynchus sp. GN=calm PE=1 SV=2 63 150 8.0E-06
sp|P62204|CALM_MOUSE Calmodulin OS=Mus musculus GN=Calm1 PE=1 SV=2 63 150 8.0E-06
sp|P62158|CALM_HUMAN Calmodulin OS=Homo sapiens GN=CALM1 PE=1 SV=2 63 150 8.0E-06
sp|Q6PI52|CALM_DANRE Calmodulin OS=Danio rerio GN=calm1a PE=2 SV=3 63 150 8.0E-06
sp|Q6IT78|CALM_CTEID Calmodulin OS=Ctenopharyngodon idella GN=calm PE=2 SV=3 63 150 8.0E-06
sp|P62149|CALM_CHICK Calmodulin OS=Gallus gallus GN=CALM PE=1 SV=2 63 150 8.0E-06
sp|P62157|CALM_BOVIN Calmodulin OS=Bos taurus GN=CALM PE=1 SV=2 63 150 8.0E-06
sp|P62144|CALM_ANAPL Calmodulin OS=Anas platyrhynchos GN=CALM PE=2 SV=2 63 150 8.0E-06
sp|P18061|CALM_TRYCR Calmodulin OS=Trypanosoma cruzi GN=CALA2 PE=3 SV=2 19 150 8.0E-06
sp|Q6R520|CALM_OREMO Calmodulin OS=Oreochromis mossambicus GN=calm PE=2 SV=3 38 150 8.0E-06
sp|Q9BLG0|TNNC_TODPA Troponin C OS=Todarodes pacificus PE=1 SV=3 33 149 9.0E-06
sp|Q9HFY6|CALM_BLAEM Calmodulin OS=Blastocladiella emersonii GN=CMD1 PE=3 SV=3 38 150 9.0E-06
sp|A8I1Q0|CALM_HETTR Calmodulin OS=Heterocapsa triquetra PE=2 SV=1 63 150 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2769
MNVSKLVADVERGLGESQNQRDSRVEDLWAQLDPGRAGELDLKGLQRGFRRIDHPMKHADELLKQIMEEVDTNHD
GKIQFEEFRTFVEQAERQLFFLFKAIDKDGNGKLDIRELQSAFRAAGLTVSNRRLSEFFNDMDKNHDGFVSFDEW
R*
Coding >Hirsu2|2769
ATGAACGTGTCCAAGCTCGTCGCCGACGTCGAACGCGGTCTTGGGGAGTCGCAGAACCAGCGTGATTCCCGCGTC
GAGGATCTCTGGGCCCAGCTGGATCCAGGTCGAGCGGGCGAGCTGGATTTGAAGGGACTGCAGAGGGGGTTCCGA
AGGATTGATCACCCCATGAAGCACGCCGACGAACTGTTGAAGCAGATTATGGAAGAGGTCGACACGAACCACGAC
GGAAAGATTCAATTCGAGGAGTTCCGCACGTTCGTCGAGCAGGCCGAGCGACAACTGTTCTTTCTGTTCAAGGCT
ATAGACAAGGATGGCAACGGGAAGCTGGACATAAGAGAGCTTCAGTCTGCCTTTCGGGCGGCTGGCTTGACCGTC
TCGAACCGCAGGCTGTCGGAGTTCTTCAACGACATGGACAAGAACCACGACGGCTTCGTAAGCTTCGACGAGTGG
CGGTAA
Transcript >Hirsu2|2769
ATGAACGTGTCCAAGCTCGTCGCCGACGTCGAACGCGGTCTTGGGGAGTCGCAGAACCAGCGTGATTCCCGCGTC
GAGGATCTCTGGGCCCAGCTGGATCCAGGTCGAGCGGGCGAGCTGGATTTGAAGGGACTGCAGAGGGGGTTCCGA
AGGATTGATCACCCCATGAAGCACGCCGACGAACTGTTGAAGCAGATTATGGAAGAGGTCGACACGAACCACGAC
GGAAAGATTCAATTCGAGGAGTTCCGCACGTTCGTCGAGCAGGCCGAGCGACAACTGTTCTTTCTGTTCAAGGCT
ATAGACAAGGATGGCAACGGGAAGCTGGACATAAGAGAGCTTCAGTCTGCCTTTCGGGCGGCTGGCTTGACCGTC
TCGAACCGCAGGCTGTCGGAGTTCTTCAACGACATGGACAAGAACCACGACGGCTTCGTAAGCTTCGACGAGTGG
CGGTAA
Gene >Hirsu2|2769
ATGAACGTGTCCAAGCTCGTCGCCGACGTCGAACGCGGTCTTGGGGAGTCGCAGAACCAGCGTGATTCCCGCGTC
GAGGATCTCTGGGCCCAGCTGGATCCAGGTCGAGCGGGCGAGCTGGATTTGAAGGGACTGCAGAGGGGGTTCCGA
AGGATTGATCACCGTGAGTCCCGTACCGCTCGGCAGTGTCGGAACCGTCTGCTCACCTTGCCGATGCAGCCATGA
AGCACGCCGACGAACTGTTGAAGCAGATTATGGAAGAGGTCGACACGAACCACGACGGAAAGATTCAATTCGAGG
GTATGCTGCATTTTCCCCGTGCTCAAAGGCTTGCGCCGTTTTTGTCGTGCCCCTCCCCTCACCCCCCTTTCCCCT
TTTTCTTCCATCGGCCTTTGCTTTGAAGCTCAAGTCACATCAATAACCCGTATTCTCTCGCAACGCAGAGTTCCG
CACGTTCGTCGAGCAGGCCGAGCGACAACTGTTCTTTCTGTTCAAGGCTATAGACAAGGATGGCAACGGGAAGCT
GGACATAAGAGAGCTTCAGTCTGCCTTTCGGGCGGCTGGCTTGACCGTCTCGAACCGCAGGCTGTCGGAGTTCTT
CAACGACATGGACAAGAACCACGACGGCTTCGTAAGCTTCGACGAGTGGCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail