Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2765
Gene name
LocationContig_1680:1521..2715
Strand+
Gene length (bp)1194
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10294 Methyltransf_16 Lysine methyltransferase 7.0E-24 162 365

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13926|YF66_SCHPO UPF0665 family protein C23C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23C4.06c PE=3 SV=1 1 375 9.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2765
MHYVRLLRPPKLSRSARATQVELVLAVTTDLGDAYLLPDEALDLVVRAEVKSSSTSAVVASCELSAHEKLQWRAG
NRVLKPTFELPPAVARAVASGDRVELCVGPAPPFSADGLRTILASSEDGAEGLVMPVWVVLGGGGANGDDDVCLR
RLRLGSAAVAAQLELEEELGDSIARHIWDASPVALAALAGAYESPGRESSRPQPCVQQLRRLFDESESINILELG
CGVGILGAGLSAVYPRARARACTILMTDLDQAAGRARSNLGLLTRQQAAGSARLLYENLDWEDGRDGRFGPLLRH
RRWDLVMLSDCTYNTDTLPALVATLSALHRYNARQVDGGDAFTSKVFIATKPRHPSERAVFDLLAKDGWSTLATQ
TLPLPVMGGEAQVVEMYLFEKE*
Coding >Hirsu2|2765
ATGCACTACGTCCGGCTCCTGCGGCCGCCCAAGCTGAGCCGCTCCGCGCGGGCAACGCAGGTGGAGCTCGTCTTG
GCCGTGACGACCGACCTCGGCGATGCCTACCTGCTGCCGGACGAGGCCCTGGATCTGGTGGTGCGCGCCGAGGTC
AAGTCGTCGTCGACCTCCGCCGTCGTGGCCTCGTGTGAGCTGTCGGCCCACGAGAAGCTGCAGTGGCGCGCCGGC
AATCGCGTGCTGAAGCCGACGTTCGAGCTCCCGCCGGCCGTCGCCAGGGCCGTCGCGTCGGGGGATAGGGTCGAG
CTGTGCGTCGGCCCCGCGCCGCCCTTTTCGGCCGACGGGCTGCGCACCATCCTCGCATCCTCCGAGGACGGCGCC
GAGGGCTTGGTGATGCCGGTCTGGGTGGTGCTGGGCGGCGGCGGCGCCAACGGGGACGACGACGTCTGCCTGCGC
AGGCTCCGTCTCGGCAGCGCCGCCGTAGCCGCCCAGCTCGAGCTGGAGGAGGAGCTGGGCGACAGCATAGCCCGT
CACATCTGGGACGCCAGCCCGGTCGCGCTGGCCGCGCTGGCGGGCGCCTACGAGTCGCCGGGCCGCGAGTCGAGC
CGGCCGCAACCGTGCGTGCAGCAGCTGCGCCGGCTGTTCGACGAGAGCGAGAGCATCAACATCCTCGAGCTCGGC
TGCGGCGTCGGCATCCTCGGCGCCGGCCTCAGCGCCGTCTACCCGCGCGCCCGCGCCCGCGCCTGCACCATCCTC
ATGACCGACCTCGACCAGGCGGCCGGCCGGGCGCGGTCCAACCTGGGCCTGCTCACCCGCCAGCAGGCGGCCGGC
AGCGCCCGCCTGCTGTACGAGAATCTGGACTGGGAGGACGGCCGGGACGGCCGGTTCGGGCCGCTGCTGCGGCAC
CGGCGCTGGGACCTGGTCATGCTCAGCGACTGCACCTACAACACGGACACGCTGCCGGCTCTGGTAGCGACGCTG
TCGGCGCTGCACCGCTACAACGCGCGCCAGGTCGACGGCGGCGACGCCTTCACCAGCAAGGTCTTCATCGCCACC
AAGCCGCGCCATCCGTCCGAGCGCGCTGTCTTCGACCTGCTGGCCAAGGACGGCTGGTCGACGCTGGCGACGCAG
ACGCTGCCGCTGCCGGTCATGGGAGGGGAGGCGCAGGTTGTGGAGATGTATCTGTTCGAGAAGGAGTGA
Transcript >Hirsu2|2765
ATGCACTACGTCCGGCTCCTGCGGCCGCCCAAGCTGAGCCGCTCCGCGCGGGCAACGCAGGTGGAGCTCGTCTTG
GCCGTGACGACCGACCTCGGCGATGCCTACCTGCTGCCGGACGAGGCCCTGGATCTGGTGGTGCGCGCCGAGGTC
AAGTCGTCGTCGACCTCCGCCGTCGTGGCCTCGTGTGAGCTGTCGGCCCACGAGAAGCTGCAGTGGCGCGCCGGC
AATCGCGTGCTGAAGCCGACGTTCGAGCTCCCGCCGGCCGTCGCCAGGGCCGTCGCGTCGGGGGATAGGGTCGAG
CTGTGCGTCGGCCCCGCGCCGCCCTTTTCGGCCGACGGGCTGCGCACCATCCTCGCATCCTCCGAGGACGGCGCC
GAGGGCTTGGTGATGCCGGTCTGGGTGGTGCTGGGCGGCGGCGGCGCCAACGGGGACGACGACGTCTGCCTGCGC
AGGCTCCGTCTCGGCAGCGCCGCCGTAGCCGCCCAGCTCGAGCTGGAGGAGGAGCTGGGCGACAGCATAGCCCGT
CACATCTGGGACGCCAGCCCGGTCGCGCTGGCCGCGCTGGCGGGCGCCTACGAGTCGCCGGGCCGCGAGTCGAGC
CGGCCGCAACCGTGCGTGCAGCAGCTGCGCCGGCTGTTCGACGAGAGCGAGAGCATCAACATCCTCGAGCTCGGC
TGCGGCGTCGGCATCCTCGGCGCCGGCCTCAGCGCCGTCTACCCGCGCGCCCGCGCCCGCGCCTGCACCATCCTC
ATGACCGACCTCGACCAGGCGGCCGGCCGGGCGCGGTCCAACCTGGGCCTGCTCACCCGCCAGCAGGCGGCCGGC
AGCGCCCGCCTGCTGTACGAGAATCTGGACTGGGAGGACGGCCGGGACGGCCGGTTCGGGCCGCTGCTGCGGCAC
CGGCGCTGGGACCTGGTCATGCTCAGCGACTGCACCTACAACACGGACACGCTGCCGGCTCTGGTAGCGACGCTG
TCGGCGCTGCACCGCTACAACGCGCGCCAGGTCGACGGCGGCGACGCCTTCACCAGCAAGGTCTTCATCGCCACC
AAGCCGCGCCATCCGTCCGAGCGCGCTGTCTTCGACCTGCTGGCCAAGGACGGCTGGTCGACGCTGGCGACGCAG
ACGCTGCCGCTGCCGGTCATGGGAGGGGAGGCGCAGGTTGTGGAGATGTATCTGTTCGAGAAGGAGTGA
Gene >Hirsu2|2765
ATGCACTACGTCCGGCTCCTGCGGCCGCCCAAGCTGAGCCGCTCCGCGCGGGCAACGCAGGTGGAGCTCGTCTTG
GCCGTGACGACCGACCTCGGCGATGCCTACCTGCTGCCGGACGAGGCCCTGGATCTGGTGGTGCGCGCCGAGGTC
AAGTCGTCGTCGACCTCCGCCGTCGTGGCCTCGTGTGAGCTGTCGGCCCACGAGAAGCTGCAGTGGCGCGCCGGC
AATCGCGTGCTGAAGCCGACGTTCGAGCTCCCGCCGGCCGTCGCCAGGGCCGTCGCGTCGGGGGATAGGGTCGAG
CTGTGCGTCGGCCCCGCGCCGCCCTTTTCGGCCGACGGGCTGCGCACCATCCTCGCATCCTCCGAGGACGGCGCC
GAGGGCTTGGTGATGCCGGTCTGGGTGGTGCTGGGCGGCGGCGGCGCCAACGGGGACGACGACGTCTGCCTGCGC
AGGCTCCGTCTCGGCAGCGCCGCCGTAGCCGCCCAGCTCGAGCTGGAGGAGGAGCTGGGCGACAGCATAGCCCGT
CACATCTGGGACGCCAGCCCGGTCGCGCTGGCCGCGCTGGCGGGCGCCTACGAGTCGCCGGGCCGCGAGTCGAGC
CGGCCGCAACCGTGCGTGCAGCAGCTGCGCCGGCTGTTCGACGAGAGCGAGAGCATCAACATCCTCGAGCTCGGC
TGCGGCGTCGGCATCCTCGGCGCCGGCCTCAGCGCCGTCTACCCGCGCGCCCGCGCCCGCGCCTGCACCATCCTC
ATGACCGACCTCGACCAGGCGGCCGGCCGGGCGCGGTCCAACCTGGGCCTGCTCACCCGCCAGCAGGCGGCCGGC
AGCGCCCGCCTGCTGTACGAGAATCTGGACTGGGAGGACGGCCGGGACGGCCGGTTCGGGCCGCTGCTGCGGCAC
CGGCGCTGGGACCTGGTCATGCTCAGCGACTGCACCTACAACACGGACACGCTGCCGGCTCTGGTAGCGACGCTG
TCGGCGCTGCACCGCTACAACGCGCGCCAGGTCGACGGCGGCGACGCCTTCACCAGCAAGGTCTTCATCGCCACC
AAGCCGCGCCATCCGTCCGAGCGCGCTGTCTTCGACCTGCTGGCCAAGGACGGCTGGTCGACGCTGGCGACGCAG
ACGCTGCCGCTGCCGGTCATGGGAGGGGAGGCGCAGGTTGTGGAGATGTATCTGTTCGAGAAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail