Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2756
Gene name
LocationContig_168:16041..16845
Strand+
Gene length (bp)804
Transcript length (bp)660
Coding sequence length (bp)660
Protein length (aa) 220

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00067 p450 Cytochrome P450 6.0E-12 38 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 13 216 1.0E-17
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 38 203 1.0E-17
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 38 203 1.0E-17
sp|C7J3A2|C7017_ORYSJ Ent-kaurene oxidase-like protein 1 OS=Oryza sativa subsp. japonica GN=CYP701A7 PE=5 SV=1 32 172 1.0E-15
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 32 172 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q078T0|PHACB_EMEND 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 13 216 1.0E-17
sp|Q4WAW8|FTME_ASPFU Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 38 203 1.0E-17
sp|B9WZX4|FTME_ASPFM Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 38 203 1.0E-17
sp|C7J3A2|C7017_ORYSJ Ent-kaurene oxidase-like protein 1 OS=Oryza sativa subsp. japonica GN=CYP701A7 PE=5 SV=1 32 172 1.0E-15
sp|Q5Z5R4|C7016_ORYSJ Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 32 172 2.0E-13
sp|Q5Z5S6|C7019_ORYSJ Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 33 193 1.0E-12
sp|Q6WNQ8|C81E8_MEDTR Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 5 172 1.0E-12
sp|Q0DBF4|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 35 105 3.0E-12
sp|A1DA63|FTME_NEOFI Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 47 203 4.0E-12
sp|O48957|C99A1_SORBI Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1 14 172 4.0E-12
sp|P48421|C83A1_ARATH Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 38 202 5.0E-12
sp|P93147|C81E1_GLYEC Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 31 219 6.0E-12
sp|P37117|C71A4_SOLME Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 38 200 8.0E-12
sp|Q64458|CP2CT_MOUSE Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 9 162 1.0E-11
sp|O65787|C71B6_ARATH Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 32 218 1.0E-11
sp|O65782|C83B1_ARATH Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 32 202 2.0E-11
sp|O22307|C71DB_LOTJA Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 36 208 4.0E-11
sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 26 185 4.0E-11
sp|Q9XHE6|C71DF_MENPI Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 7 200 4.0E-11
sp|F8S1H3|C7BL1_HELAN Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 34 168 5.0E-11
sp|Q0JF01|C99A3_ORYSJ 9-beta-pimara-7,15-diene oxidase OS=Oryza sativa subsp. japonica GN=CYP99A3 PE=1 SV=1 4 200 8.0E-11
sp|P24461|CP2G1_RABIT Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 3 107 9.0E-11
sp|C0SJS3|ANGS_PASSA Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 36 184 9.0E-11
sp|Q64678|CP1B1_RAT Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 17 108 1.0E-10
sp|Q64429|CP1B1_MOUSE Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 17 108 1.0E-10
sp|Q6XQ14|C71E7_MANES 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 38 208 1.0E-10
sp|G3GBK0|C7BL3_CICIN Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 36 114 2.0E-10
sp|Q6VVW9|CP2R1_MOUSE Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 32 215 2.0E-10
sp|Q7X7X4|C99A2_ORYSJ Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 38 200 2.0E-10
sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 18 105 2.0E-10
sp|O54749|CP2J5_MOUSE Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 12 105 2.0E-10
sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 25 208 2.0E-10
sp|F8S1I0|C7BL2_LACSA Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 13 169 2.0E-10
sp|Q5Z5R7|C701S_ORYSJ Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 42 172 3.0E-10
sp|P20852|CP2A5_MOUSE Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 13 107 3.0E-10
sp|P52786|CP2J1_RABIT Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 32 106 3.0E-10
sp|P56594|CP2CL_CANLF Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 18 108 3.0E-10
sp|Q9Y7G5|PHACA_EMEND Phenylacetate 2-hydroxylase OS=Emericella nidulans GN=phacA PE=1 SV=1 9 219 4.0E-10
sp|P37119|C71A3_SOLME Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1 38 115 4.0E-10
sp|H2DH20|C7D13_PANGI Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 36 214 4.0E-10
sp|P98183|C71DC_CATRO Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 38 215 4.0E-10
sp|Q9CA60|C98A9_ARATH Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 32 97 4.0E-10
sp|Q9T0K0|C71AJ_ARATH Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 36 215 4.0E-10
sp|Q9T0K2|C71AK_ARATH Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 27 215 5.0E-10
sp|Q9D816|CP255_MOUSE Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 25 193 5.0E-10
sp|P93531|C71D7_SOLCH Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 25 200 5.0E-10
sp|C0SJS2|C71AJ_PASSA Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 15 184 6.0E-10
sp|P58048|C71B8_ARATH Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 38 147 6.0E-10
sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 19 105 7.0E-10
sp|Q05555|CP2AA_RABIT Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 19 107 7.0E-10
sp|P20812|CP2A3_RAT Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 8 107 7.0E-10
sp|Q9LIP6|C71BV_ARATH Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 12 199 8.0E-10
sp|O65786|C71B4_ARATH Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 27 200 9.0E-10
sp|Q9LTM7|C71BG_ARATH Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 13 152 1.0E-09
sp|Q6WNR0|C81E7_MEDTR Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 15 182 1.0E-09
sp|Q9ZU07|C71BC_ARATH Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 21 213 1.0E-09
sp|P33273|CP255_RAT Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 38 162 2.0E-09
sp|Q9LTM2|C71BL_ARATH Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 38 200 2.0E-09
sp|O54750|CP2J6_MOUSE Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 31 106 2.0E-09
sp|P05182|CP2E1_RAT Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 7 119 2.0E-09
sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 30 105 2.0E-09
sp|Q05556|CP2AB_RABIT Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 19 107 2.0E-09
sp|Q9LIP5|C71BW_ARATH Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 39 200 2.0E-09
sp|P49264|C71B1_THLAR Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 32 159 3.0E-09
sp|A6YIH8|C7D55_HYOMU Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 38 200 3.0E-09
sp|Q9MZY0|CP2E1_CANLF Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 6 119 3.0E-09
sp|P51581|CP2E1_MESAU Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 7 119 3.0E-09
sp|Q96514|C71B7_ARATH Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 7 207 4.0E-09
sp|P11711|CP2A1_RAT Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 3 202 4.0E-09
sp|O65785|C71B3_ARATH Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 18 148 5.0E-09
sp|Q16696|CP2AD_HUMAN Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 19 107 5.0E-09
sp|Q29497|CP17A_SHEEP Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 12 107 6.0E-09
sp|P11509|CP2A6_HUMAN Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 13 107 6.0E-09
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 9 123 6.0E-09
sp|C0SJS4|C71AJ_APIGR Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 15 123 6.0E-09
sp|O48928|C77A3_SOYBN Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 12 181 6.0E-09
sp|P30437|CP17A_ONCMY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 38 152 7.0E-09
sp|P58049|C71BB_ARATH Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 21 106 8.0E-09
sp|Q9LTM3|C71BK_ARATH Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 11 153 9.0E-09
sp|O48956|C98A1_SORBI Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 38 202 1.0E-08
sp|Q42799|C93A2_SOYBN Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 11 213 1.0E-08
sp|Q9LTM4|C71BJ_ARATH Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 17 122 1.0E-08
sp|P24455|CP2A9_MESAU Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 8 107 1.0E-08
sp|O48923|C71DA_SOYBN Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 35 200 1.0E-08
sp|Q9STK9|C71AO_ARATH Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 33 118 1.0E-08
sp|Q9STL2|C71AL_ARATH Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 17 118 1.0E-08
sp|Q9N0U7|CP17A_CAPHI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 12 107 1.0E-08
sp|P15392|CP2A4_MOUSE Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 13 107 1.0E-08
sp|Q64410|CP17A_CAVPO Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 29 106 2.0E-08
sp|Q9STK8|C71AP_ARATH Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 33 202 2.0E-08
sp|P37123|C77A1_SOLME Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 36 116 2.0E-08
sp|O81970|C71A9_SOYBN Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 38 208 2.0E-08
sp|P37118|C71A2_SOLME Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 39 215 2.0E-08
sp|Q9GMC8|CP17A_FELCA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 35 148 2.0E-08
sp|S4UX02|CYPH1_SALMI Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 32 105 3.0E-08
sp|H2DH18|C7A12_PANGI Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 32 112 3.0E-08
sp|O18809|CP2F3_CAPHI Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 38 108 3.0E-08
sp|Q92113|CP17A_SQUAC Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 13 154 3.0E-08
sp|Q9LTM1|C71BM_ARATH Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 38 200 3.0E-08
sp|Q42798|C93A1_SOYBN 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 11 213 3.0E-08
sp|P51589|CP2J2_HUMAN Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 32 106 3.0E-08
sp|O65790|C81F1_ARATH Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 36 106 4.0E-08
sp|P33263|CP2CQ_MESAU Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 9 123 4.0E-08
sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 31 118 5.0E-08
sp|Q948Y1|C719A_COPJA (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 37 200 5.0E-08
sp|P24454|CP2A8_MESAU Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 19 107 5.0E-08
sp|Q92088|CP2M1_ONCMY Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 8 118 5.0E-08
sp|Q6XVG2|CP254_MOUSE Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 13 105 5.0E-08
sp|Q54SV9|C515B_DICDI Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 9 159 6.0E-08
sp|P20853|CP2A7_HUMAN Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 19 107 6.0E-08
sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 36 118 6.0E-08
sp|Q29473|CP2DF_CANLF Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 1 106 7.0E-08
sp|P58050|C71BD_ARATH Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 12 105 7.0E-08
sp|Q54Q53|C519B_DICDI Probable cytochrome P450 519B1 OS=Dictyostelium discoideum GN=cyp519B1 PE=3 SV=1 19 107 7.0E-08
sp|P12938|CP2D3_RAT Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 13 114 7.0E-08
sp|P08682|CP2E1_RABIT Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 6 119 7.0E-08
sp|Q9LTM6|C71BH_ARATH Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 29 122 8.0E-08
sp|P58051|C71BE_ARATH Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 36 106 8.0E-08
sp|Q16678|CP1B1_HUMAN Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 38 108 8.0E-08
sp|P05181|CP2E1_HUMAN Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 6 119 9.0E-08
sp|P58045|C71AE_ARATH Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 27 172 9.0E-08
sp|P19100|CP17A_PIG Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 35 154 9.0E-08
sp|Q9STL0|C71AN_ARATH Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 39 197 9.0E-08
sp|P51590|CP2J3_RAT Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 32 118 1.0E-07
sp|P56655|CP238_MOUSE Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 25 162 1.0E-07
sp|O81974|C71D8_SOYBN Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 22 208 1.0E-07
sp|Q54KV0|C513B_DICDI Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 39 86 1.0E-07
sp|Q95328|CP17A_HORSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 35 107 1.0E-07
sp|P56654|CP237_MOUSE Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 13 108 1.0E-07
sp|P11371|CP2C4_RABIT Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 25 123 2.0E-07
sp|P58046|C71AF_ARATH Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 36 202 2.0E-07
sp|P05179|CP2C7_RAT Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 25 123 2.0E-07
sp|P15149|CP2A2_RAT Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 3 107 2.0E-07
sp|Q92039|CP1A1_CHACA Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 3 152 2.0E-07
sp|Q9CA61|C98A8_ARATH Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 35 97 2.0E-07
sp|P56657|CP240_MOUSE Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 19 105 2.0E-07
sp|O22203|C98A3_ARATH Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 11 207 2.0E-07
sp|P08683|CP2CB_RAT Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 25 123 2.0E-07
sp|Q9STL1|C71AM_ARATH Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 33 115 2.0E-07
sp|O65784|C71B5_ARATH Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1 38 200 2.0E-07
sp|Q8HYN0|CP17A_PAPCY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 35 148 2.0E-07
sp|Q94FM7|C71DK_TOBAC 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 38 200 2.0E-07
sp|Q9GLD2|CP17A_PAPHU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 35 148 2.0E-07
sp|Q8HYM9|CP17A_MACMU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 35 148 2.0E-07
sp|Q2XVA1|CP17A_MACFA Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 35 148 2.0E-07
sp|P56593|CP2AC_MOUSE Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 19 107 2.0E-07
sp|Q54SN0|C513E_DICDI Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 28 105 2.0E-07
sp|Q9LTL8|C71BO_ARATH Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 17 160 3.0E-07
sp|Q93ZB2|KO1_ARATH Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 39 165 3.0E-07
sp|P04799|CP1A2_RAT Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 13 118 3.0E-07
sp|Q6GUQ4|CP2E1_MACMU Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 36 119 3.0E-07
sp|Q6JZS3|CP1A1_ORYLA Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 7 209 3.0E-07
sp|Q6QNI4|C71AJ_AMMMJ Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 36 123 4.0E-07
sp|Q9LXM3|C71BZ_ARATH Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2 38 200 4.0E-07
sp|Q29510|CP2CU_RABIT Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 38 105 4.0E-07
sp|Q8TAV3|CP2W1_HUMAN Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 35 178 4.0E-07
sp|P10632|CP2C8_HUMAN Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 9 119 4.0E-07
sp|P56656|CP239_MOUSE Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 25 162 4.0E-07
sp|Q9SCN2|C71BU_ARATH Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 38 122 4.0E-07
sp|Q91X77|CY250_MOUSE Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 13 162 4.0E-07
sp|P12939|CP2DA_RAT Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 13 152 5.0E-07
sp|P79383|CP2E1_PIG Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 38 119 5.0E-07
sp|Q9GMC7|CP17A_BISBI Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 35 107 5.0E-07
sp|P05185|CP17A_BOVIN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 35 107 5.0E-07
sp|P79761|CP1A5_CHICK Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 38 159 5.0E-07
sp|Q9VW43|CP305_DROME Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 9 110 5.0E-07
sp|P24453|CP1A2_MESAU Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 1 118 6.0E-07
sp|P24470|CP2CN_RAT Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 13 105 6.0E-07
sp|Q00557|CP1A1_MESAU Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 13 118 6.0E-07
sp|P00186|CP1A2_MOUSE Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 13 118 6.0E-07
sp|P00185|CP1A1_RAT Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 13 118 6.0E-07
sp|Q91W64|CP270_MOUSE Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 9 125 6.0E-07
sp|O81928|TCMO_CICAR Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 38 219 7.0E-07
sp|P15123|CP2CG_RABIT Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 25 123 7.0E-07
sp|O18963|CP2E1_BOVIN Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 6 107 7.0E-07
sp|P19225|CP270_RAT Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 9 105 7.0E-07
sp|Q9LTL2|C71BP_ARATH Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 36 148 8.0E-07
sp|Q9LVD2|C71BA_ARATH Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 27 106 8.0E-07
sp|P11715|CP17A_RAT Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 35 116 8.0E-07
sp|Q9STK7|C71AQ_ARATH Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 36 115 9.0E-07
sp|P33260|CP2CI_HUMAN Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 38 123 9.0E-07
sp|O35293|CP2F2_RAT Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 38 105 9.0E-07
sp|P10610|CP2G1_RAT Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 33 107 9.0E-07
sp|O62671|CP241_CANLF Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 33 114 9.0E-07
sp|O48958|C71E1_SORBI 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 38 200 1.0E-06
sp|O57525|CP17A_RANDY Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 25 152 1.0E-06
sp|Q9LIP4|C71BX_ARATH Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 38 200 1.0E-06
sp|P05093|CP17A_HUMAN Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 35 107 1.0E-06
sp|Q9SAE3|C71BS_ARATH Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 33 207 1.0E-06
sp|Q8HYN1|CP17A_PANTR Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 35 107 1.0E-06
sp|Q8CIM7|CP2DQ_MOUSE Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 18 106 1.0E-06
sp|Q4V8D1|CP2U1_RAT Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 32 202 1.0E-06
sp|P33262|CP2CK_MACFA Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 13 105 2.0E-06
sp|Q1PS23|AMO_ARTAN Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 14 200 2.0E-06
sp|P33261|CP2CJ_HUMAN Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 24 123 2.0E-06
sp|D5JBW9|GAO_SAUCO Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 14 200 2.0E-06
sp|O73853|CP17A_ICTPU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 38 152 3.0E-06
sp|P48522|TCMO_CATRO Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 27 219 3.0E-06
sp|P33267|CP2F2_MOUSE Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 32 105 3.0E-06
sp|P00179|CP2C5_RABIT Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 24 143 3.0E-06
sp|Q92095|CP1A1_OPSTA Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 39 152 3.0E-06
sp|Q9XHC6|C93E1_SOYBN Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 38 208 3.0E-06
sp|P10633|CP2D1_RAT Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 13 106 3.0E-06
sp|Q9VWR5|CP306_DROME Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 3 116 3.0E-06
sp|Q9CX98|CP2U1_MOUSE Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 32 152 4.0E-06
sp|Q9XHE8|C71DI_MENSP Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 1 200 4.0E-06
sp|Q6WKZ1|C71DI_MENGR Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 1 200 4.0E-06
sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 33 105 4.0E-06
sp|H2DH22|C7A10_PANGI Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 35 147 4.0E-06
sp|P70687|CP17A_MESAU Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 35 106 5.0E-06
sp|P24456|CP2DA_MOUSE Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 13 107 5.0E-06
sp|O55071|CP2BJ_MOUSE Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 35 105 5.0E-06
sp|Q92110|CP1A1_ONCMY Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 39 202 5.0E-06
sp|P13108|CP2D4_RAT Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 13 110 5.0E-06
sp|P20814|CP2CD_RAT Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 38 114 6.0E-06
sp|Q64680|CP2DI_RAT Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 13 110 6.0E-06
sp|P27786|CP17A_MOUSE Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 35 107 6.0E-06
sp|P11712|CP2C9_HUMAN Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 25 123 6.0E-06
sp|P33272|CP2BC_RAT Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 35 105 7.0E-06
sp|P05177|CP1A2_HUMAN Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 13 208 7.0E-06
sp|Q92116|CP1A1_STECH Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 39 152 7.0E-06
sp|Q64583|CP2BF_RAT Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 35 105 7.0E-06
sp|O65788|C71B2_ARATH Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 6 148 8.0E-06
sp|O42231|CP1A1_LIZAU Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 7 152 9.0E-06
sp|I3V6B1|C80BX_PAPSO (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 34 105 9.0E-06
sp|Q9SAB6|C71AI_ARATH Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 33 202 9.0E-06
sp|P00184|CP1A1_MOUSE Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 13 118 9.0E-06
sp|O81973|C93A3_SOYBN Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 11 213 9.0E-06
sp|P00178|CP2B4_RABIT Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 38 115 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0046872 metal ion binding No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0043169 cation binding No
GO:0008152 metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0048037 cofactor binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 27 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2756
MGVETTSVLQAWMALAIAMLSLVVWRVNRIGRRPANYPPGPPTLPLIGNLHQMPKANGHLQFQKWAREYGPVYSL
MLGPKVMVVLSSDVAVKDLLDKRSAIYSSRPEFYLAQTILSRGLRPLFMVRQYIPFLSSKEYGSMVRMVRKLAHS
VLNVTVARSYVPYQDLEIKAMLMGLLDSPESFINHIRRYTTSLTTQMAFGYRTPTSEDPNLIEMFDGAR*
Coding >Hirsu2|2756
ATGGGCGTGGAAACGACGTCTGTGCTCCAGGCTTGGATGGCCCTGGCCATAGCCATGCTCAGCTTGGTAGTCTGG
CGAGTCAACAGGATCGGGCGGCGTCCCGCGAACTATCCGCCGGGGCCTCCGACCTTGCCTCTCATCGGAAATCTT
CACCAGATGCCCAAGGCCAACGGGCATCTGCAGTTCCAGAAATGGGCACGGGAGTACGGGCCGGTGTATTCGCTC
ATGCTGGGGCCCAAGGTCATGGTCGTCTTGTCGTCGGACGTGGCGGTCAAAGACCTGCTCGACAAGCGAAGTGCC
ATCTACTCGTCGAGGCCGGAGTTCTATCTGGCACAGACGATCCTGAGCAGAGGCTTGCGGCCATTGTTCATGGTG
CGCCAGTACATACCCTTTCTGAGCTCAAAGGAATACGGCAGCATGGTGCGTATGGTCCGCAAGCTTGCCCACAGC
GTCCTGAACGTGACGGTTGCTCGAAGCTATGTACCGTACCAAGACCTGGAGATCAAAGCCATGTTGATGGGGCTT
CTCGACAGTCCGGAAAGCTTCATCAATCACATACGTCGATACACAACGTCCCTGACCACACAGATGGCCTTTGGC
TATCGTACGCCGACGAGCGAGGATCCGAACTTGATAGAGATGTTTGACGGAGCCAGGTGA
Transcript >Hirsu2|2756
ATGGGCGTGGAAACGACGTCTGTGCTCCAGGCTTGGATGGCCCTGGCCATAGCCATGCTCAGCTTGGTAGTCTGG
CGAGTCAACAGGATCGGGCGGCGTCCCGCGAACTATCCGCCGGGGCCTCCGACCTTGCCTCTCATCGGAAATCTT
CACCAGATGCCCAAGGCCAACGGGCATCTGCAGTTCCAGAAATGGGCACGGGAGTACGGGCCGGTGTATTCGCTC
ATGCTGGGGCCCAAGGTCATGGTCGTCTTGTCGTCGGACGTGGCGGTCAAAGACCTGCTCGACAAGCGAAGTGCC
ATCTACTCGTCGAGGCCGGAGTTCTATCTGGCACAGACGATCCTGAGCAGAGGCTTGCGGCCATTGTTCATGGTG
CGCCAGTACATACCCTTTCTGAGCTCAAAGGAATACGGCAGCATGGTGCGTATGGTCCGCAAGCTTGCCCACAGC
GTCCTGAACGTGACGGTTGCTCGAAGCTATGTACCGTACCAAGACCTGGAGATCAAAGCCATGTTGATGGGGCTT
CTCGACAGTCCGGAAAGCTTCATCAATCACATACGTCGATACACAACGTCCCTGACCACACAGATGGCCTTTGGC
TATCGTACGCCGACGAGCGAGGATCCGAACTTGATAGAGATGTTTGACGGAGCCAGGTGA
Gene >Hirsu2|2756
ATGGGCGTGGAAACGACGTCTGTGCTCCAGGCTTGGATGGCCCTGGCCATAGCCATGCTCAGCTTGGTAGTCTGG
CGAGTCAACAGGATCGGGCGGCGTCCCGCGAACTATCCGCCGGGGCCTCCGACCTTGCCTCTCATCGGAAATCTT
CACCAGATGCCCAAGGCCAACGGGCATCTGCAGTTCCAGAAATGGGCACGGGAGTACGGGCCGGTGTATTCGCTC
ATGCTGGGGCCCAAGGTCATGGTCGTCTTGTCGTCGGACGTGGCGGTCAAAGACCTGCTCGACAAGCGAAGTGCC
ATCTACTCGTCGAGGCCGGAGTTCTATCTGGCACAGACGATCCTGAGCAGAGGCTTGCGGCCATTGTTCATGGTG
CGCCAGTACATACCCTTTCTGAGCTCAAAGGTGCGAGTCGGCGGGAGTTACGATGCCAAACTGACCGTGCTCGAA
CATGAGGATGGCAGGAATACGGCAGCATGGTGCGTATGGTCCGCAAGCTTGCCCACAGCGTCCTGAACGTGACGG
TTGCTCGAAGCTATGTACCGTACCAAGACCTGGAGATCAAAGCCATGTTGATGGGGCTTCTCGACAGTCCGGAAA
GCTTCATCAATCACATACGTCGATACACAACGTCCCTGACCACACAGATGGCCTTTGGCTATCGTACGCCGACGA
GCGAGGATCCGAACTTGATAGAGATGTTTGACGTGAGTGACAGACCTGTCGTTGAGTGGCGAACGGAATGTGTTG
ACAAGACAGCGTAGAACTTCGAACGACTCTCCGAGCTTGCAGGGAGCCAGGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail