© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|2756 |
| Gene name | |
| Location | Contig_168:16041..16845 |
| Strand | + |
| Gene length (bp) | 804 |
| Transcript length (bp) | 660 |
| Coding sequence length (bp) | 660 |
| Protein length (aa) | 220 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 6.5E-12 | 38 | 112 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q078T0|PHACB_EMEND | 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 | 13 | 216 | 1.0E-17 |
| sp|Q4WAW8|FTME_ASPFU | Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 | 38 | 203 | 1.0E-17 |
| sp|B9WZX4|FTME_ASPFM | Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 | 38 | 203 | 1.0E-17 |
| sp|C7J3A2|C7017_ORYSJ | Ent-kaurene oxidase-like protein 1 OS=Oryza sativa subsp. japonica GN=CYP701A7 PE=5 SV=1 | 32 | 172 | 1.0E-15 |
| sp|Q5Z5R4|C7016_ORYSJ | Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 | 32 | 172 | 2.0E-13 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q078T0|PHACB_EMEND | 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 | 13 | 216 | 1.0E-17 |
| sp|Q4WAW8|FTME_ASPFU | Fumitremorgin C synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-2 PE=3 SV=1 | 38 | 203 | 1.0E-17 |
| sp|B9WZX4|FTME_ASPFM | Fumitremorgin C synthase OS=Neosartorya fumigata GN=ftmP450-2 PE=1 SV=1 | 38 | 203 | 1.0E-17 |
| sp|C7J3A2|C7017_ORYSJ | Ent-kaurene oxidase-like protein 1 OS=Oryza sativa subsp. japonica GN=CYP701A7 PE=5 SV=1 | 32 | 172 | 1.0E-15 |
| sp|Q5Z5R4|C7016_ORYSJ | Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 | 32 | 172 | 2.0E-13 |
| sp|Q5Z5S6|C7019_ORYSJ | Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 | 33 | 193 | 1.0E-12 |
| sp|Q6WNQ8|C81E8_MEDTR | Cytochrome P450 81E8 OS=Medicago truncatula GN=CYP81E8 PE=2 SV=1 | 5 | 172 | 1.0E-12 |
| sp|Q0DBF4|C7018_ORYSJ | Ent-sandaracopimaradiene 3-hydroxylase OS=Oryza sativa subsp. japonica GN=CYP701A8 PE=1 SV=1 | 35 | 105 | 3.0E-12 |
| sp|A1DA63|FTME_NEOFI | Fumitremorgin C synthase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmP450-2 PE=3 SV=1 | 47 | 203 | 4.0E-12 |
| sp|O48957|C99A1_SORBI | Cytochrome P450 CYP99A1 (Fragment) OS=Sorghum bicolor GN=CYP99A1 PE=2 SV=1 | 14 | 172 | 4.0E-12 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 38 | 202 | 5.0E-12 |
| sp|P93147|C81E1_GLYEC | Isoflavone 2'-hydroxylase OS=Glycyrrhiza echinata GN=CYP81E1 PE=1 SV=2 | 31 | 219 | 6.0E-12 |
| sp|P37117|C71A4_SOLME | Cytochrome P450 71A4 OS=Solanum melongena GN=CYP71A4 PE=2 SV=1 | 38 | 200 | 8.0E-12 |
| sp|Q64458|CP2CT_MOUSE | Cytochrome P450 2C29 OS=Mus musculus GN=Cyp2c29 PE=1 SV=2 | 9 | 162 | 1.0E-11 |
| sp|O65787|C71B6_ARATH | Cytochrome P450 71B6 OS=Arabidopsis thaliana GN=CYP71B6 PE=2 SV=1 | 32 | 218 | 1.0E-11 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 32 | 202 | 2.0E-11 |
| sp|O22307|C71DB_LOTJA | Cytochrome P450 71D11 (Fragment) OS=Lotus japonicus GN=CYP71D11 PE=2 SV=1 | 36 | 208 | 4.0E-11 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 26 | 185 | 4.0E-11 |
| sp|Q9XHE6|C71DF_MENPI | Cytochrome P450 71D15 OS=Mentha piperita GN=CYP71D15 PE=1 SV=1 | 7 | 200 | 4.0E-11 |
| sp|F8S1H3|C7BL1_HELAN | Cytochrome P450 71BL1 OS=Helianthus annuus GN=CYP71BL1 PE=2 SV=1 | 34 | 168 | 5.0E-11 |
| sp|Q0JF01|C99A3_ORYSJ | 9-beta-pimara-7,15-diene oxidase OS=Oryza sativa subsp. japonica GN=CYP99A3 PE=1 SV=1 | 4 | 200 | 8.0E-11 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 3 | 107 | 9.0E-11 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 36 | 184 | 9.0E-11 |
| sp|Q64678|CP1B1_RAT | Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 | 17 | 108 | 1.0E-10 |
| sp|Q64429|CP1B1_MOUSE | Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 | 17 | 108 | 1.0E-10 |
| sp|Q6XQ14|C71E7_MANES | 2-methylbutanal oxime monooxygenase OS=Manihot esculenta GN=CYP71E7 PE=1 SV=1 | 38 | 208 | 1.0E-10 |
| sp|G3GBK0|C7BL3_CICIN | Costunolide synthase OS=Cichorium intybus GN=CYP71BL3 PE=1 SV=1 | 36 | 114 | 2.0E-10 |
| sp|Q6VVW9|CP2R1_MOUSE | Vitamin D 25-hydroxylase OS=Mus musculus GN=Cyp2r1 PE=2 SV=1 | 32 | 215 | 2.0E-10 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 38 | 200 | 2.0E-10 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 18 | 105 | 2.0E-10 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 12 | 105 | 2.0E-10 |
| sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 25 | 208 | 2.0E-10 |
| sp|F8S1I0|C7BL2_LACSA | Costunolide synthase OS=Lactuca sativa GN=CYP71BL2 PE=1 SV=1 | 13 | 169 | 2.0E-10 |
| sp|Q5Z5R7|C701S_ORYSJ | Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 | 42 | 172 | 3.0E-10 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 13 | 107 | 3.0E-10 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 32 | 106 | 3.0E-10 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 18 | 108 | 3.0E-10 |
| sp|Q9Y7G5|PHACA_EMEND | Phenylacetate 2-hydroxylase OS=Emericella nidulans GN=phacA PE=1 SV=1 | 9 | 219 | 4.0E-10 |
| sp|P37119|C71A3_SOLME | Cytochrome P450 71A3 (Fragment) OS=Solanum melongena GN=CYP71A3 PE=2 SV=1 | 38 | 115 | 4.0E-10 |
| sp|H2DH20|C7D13_PANGI | Cytochrome P450 CYP71D313 OS=Panax ginseng PE=2 SV=1 | 36 | 214 | 4.0E-10 |
| sp|P98183|C71DC_CATRO | Tabersonine 16-hydroxylase (Fragment) OS=Catharanthus roseus GN=CYP71D12 PE=1 SV=1 | 38 | 215 | 4.0E-10 |
| sp|Q9CA60|C98A9_ARATH | Cytochrome P450 98A9 OS=Arabidopsis thaliana GN=CYP98A9 PE=1 SV=1 | 32 | 97 | 4.0E-10 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 36 | 215 | 4.0E-10 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 27 | 215 | 5.0E-10 |
| sp|Q9D816|CP255_MOUSE | Cytochrome P450 2C55 OS=Mus musculus GN=Cyp2c55 PE=1 SV=1 | 25 | 193 | 5.0E-10 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 25 | 200 | 5.0E-10 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 15 | 184 | 6.0E-10 |
| sp|P58048|C71B8_ARATH | Cytochrome P450 71B8 OS=Arabidopsis thaliana GN=CYP71B8 PE=3 SV=1 | 38 | 147 | 6.0E-10 |
| sp|O23976|C76B1_HELTU | 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 | 19 | 105 | 7.0E-10 |
| sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 19 | 107 | 7.0E-10 |
| sp|P20812|CP2A3_RAT | Cytochrome P450 2A3 OS=Rattus norvegicus GN=Cyp2a3 PE=2 SV=1 | 8 | 107 | 7.0E-10 |
| sp|Q9LIP6|C71BV_ARATH | Cytochrome P450 71B34 OS=Arabidopsis thaliana GN=CYP71B34 PE=2 SV=1 | 12 | 199 | 8.0E-10 |
| sp|O65786|C71B4_ARATH | Cytochrome P450 71B4 OS=Arabidopsis thaliana GN=CYP71B4 PE=2 SV=2 | 27 | 200 | 9.0E-10 |
| sp|Q9LTM7|C71BG_ARATH | Cytochrome P450 71B16 OS=Arabidopsis thaliana GN=CYP71B16 PE=3 SV=1 | 13 | 152 | 1.0E-09 |
| sp|Q6WNR0|C81E7_MEDTR | Isoflavone 2'-hydroxylase OS=Medicago truncatula GN=CYP81E7 PE=1 SV=1 | 15 | 182 | 1.0E-09 |
| sp|Q9ZU07|C71BC_ARATH | Cytochrome P450 71B12 OS=Arabidopsis thaliana GN=CYP71B12 PE=2 SV=1 | 21 | 213 | 1.0E-09 |
| sp|P33273|CP255_RAT | Cytochrome P450 2C55 OS=Rattus norvegicus GN=Cyp2c55 PE=2 SV=2 | 38 | 162 | 2.0E-09 |
| sp|Q9LTM2|C71BL_ARATH | Cytochrome P450 71B21 OS=Arabidopsis thaliana GN=CYP71B21 PE=3 SV=1 | 38 | 200 | 2.0E-09 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 31 | 106 | 2.0E-09 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 7 | 119 | 2.0E-09 |
| sp|Q8VWZ7|C76B6_CATRO | Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 | 30 | 105 | 2.0E-09 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 19 | 107 | 2.0E-09 |
| sp|Q9LIP5|C71BW_ARATH | Cytochrome P450 71B35 OS=Arabidopsis thaliana GN=CYP71B35 PE=2 SV=1 | 39 | 200 | 2.0E-09 |
| sp|P49264|C71B1_THLAR | Cytochrome P450 71B1 OS=Thlaspi arvense GN=CYP71B1 PE=2 SV=1 | 32 | 159 | 3.0E-09 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 38 | 200 | 3.0E-09 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 6 | 119 | 3.0E-09 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 7 | 119 | 3.0E-09 |
| sp|Q96514|C71B7_ARATH | Cytochrome P450 71B7 OS=Arabidopsis thaliana GN=CYP71B7 PE=1 SV=1 | 7 | 207 | 4.0E-09 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 3 | 202 | 4.0E-09 |
| sp|O65785|C71B3_ARATH | Cytochrome P450 71B3 OS=Arabidopsis thaliana GN=CYP71B3 PE=2 SV=2 | 18 | 148 | 5.0E-09 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 19 | 107 | 5.0E-09 |
| sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 12 | 107 | 6.0E-09 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 13 | 107 | 6.0E-09 |
| sp|Q08078|CP2CP_MESAU | Cytochrome P450 2C25 OS=Mesocricetus auratus GN=CYP2C25 PE=2 SV=1 | 9 | 123 | 6.0E-09 |
| sp|C0SJS4|C71AJ_APIGR | Psoralen synthase (Fragment) OS=Apium graveolens GN=CYP71AJ2 PE=1 SV=1 | 15 | 123 | 6.0E-09 |
| sp|O48928|C77A3_SOYBN | Cytochrome P450 77A3 OS=Glycine max GN=CYP77A3 PE=2 SV=1 | 12 | 181 | 6.0E-09 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 38 | 152 | 7.0E-09 |
| sp|P58049|C71BB_ARATH | Cytochrome P450 71B11 OS=Arabidopsis thaliana GN=CYP71B11 PE=2 SV=1 | 21 | 106 | 8.0E-09 |
| sp|Q9LTM3|C71BK_ARATH | Cytochrome P450 71B20 OS=Arabidopsis thaliana GN=CYP71B20 PE=2 SV=1 | 11 | 153 | 9.0E-09 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 38 | 202 | 1.0E-08 |
| sp|Q42799|C93A2_SOYBN | Cytochrome P450 93A2 OS=Glycine max GN=CYP93A2 PE=2 SV=1 | 11 | 213 | 1.0E-08 |
| sp|Q9LTM4|C71BJ_ARATH | Cytochrome P450 71B19 OS=Arabidopsis thaliana GN=CYP71B19 PE=2 SV=1 | 17 | 122 | 1.0E-08 |
| sp|P24455|CP2A9_MESAU | Cytochrome P450 2A9 OS=Mesocricetus auratus GN=CYP2A9 PE=2 SV=2 | 8 | 107 | 1.0E-08 |
| sp|O48923|C71DA_SOYBN | Cytochrome P450 71D10 OS=Glycine max GN=CYP71D10 PE=2 SV=1 | 35 | 200 | 1.0E-08 |
| sp|Q9STK9|C71AO_ARATH | Cytochrome P450 71A24 OS=Arabidopsis thaliana GN=CYP71A24 PE=2 SV=3 | 33 | 118 | 1.0E-08 |
| sp|Q9STL2|C71AL_ARATH | Cytochrome P450 71A21 OS=Arabidopsis thaliana GN=CYP71A21 PE=2 SV=1 | 17 | 118 | 1.0E-08 |
| sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 12 | 107 | 1.0E-08 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 13 | 107 | 1.0E-08 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 29 | 106 | 2.0E-08 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 33 | 202 | 2.0E-08 |
| sp|P37123|C77A1_SOLME | Cytochrome P450 77A1 (Fragment) OS=Solanum melongena GN=CYP77A1 PE=2 SV=1 | 36 | 116 | 2.0E-08 |
| sp|O81970|C71A9_SOYBN | Cytochrome P450 71A9 OS=Glycine max GN=CYP71A9 PE=2 SV=1 | 38 | 208 | 2.0E-08 |
| sp|P37118|C71A2_SOLME | Cytochrome P450 71A2 OS=Solanum melongena GN=CYP71A2 PE=2 SV=1 | 39 | 215 | 2.0E-08 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 35 | 148 | 2.0E-08 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 32 | 105 | 3.0E-08 |
| sp|H2DH18|C7A12_PANGI | Cytochrome P450 CYP736A12 OS=Panax ginseng PE=2 SV=1 | 32 | 112 | 3.0E-08 |
| sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 38 | 108 | 3.0E-08 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 13 | 154 | 3.0E-08 |
| sp|Q9LTM1|C71BM_ARATH | Cytochrome P450 71B22 OS=Arabidopsis thaliana GN=CYP71B22 PE=2 SV=1 | 38 | 200 | 3.0E-08 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 11 | 213 | 3.0E-08 |
| sp|P51589|CP2J2_HUMAN | Cytochrome P450 2J2 OS=Homo sapiens GN=CYP2J2 PE=1 SV=2 | 32 | 106 | 3.0E-08 |
| sp|O65790|C81F1_ARATH | Cytochrome P450 81F1 OS=Arabidopsis thaliana GN=CYP81F1 PE=2 SV=2 | 36 | 106 | 4.0E-08 |
| sp|P33263|CP2CQ_MESAU | Cytochrome P450 2C26 OS=Mesocricetus auratus GN=CYP2C26 PE=2 SV=1 | 9 | 123 | 4.0E-08 |
| sp|O64899|C80B1_ESCCA | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 | 31 | 118 | 5.0E-08 |
| sp|Q948Y1|C719A_COPJA | (S)-canadine synthase OS=Coptis japonica GN=CYP719A1 PE=1 SV=1 | 37 | 200 | 5.0E-08 |
| sp|P24454|CP2A8_MESAU | Cytochrome P450 2A8 OS=Mesocricetus auratus GN=CYP2A8 PE=1 SV=1 | 19 | 107 | 5.0E-08 |
| sp|Q92088|CP2M1_ONCMY | Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 | 8 | 118 | 5.0E-08 |
| sp|Q6XVG2|CP254_MOUSE | Cytochrome P450 2C54 OS=Mus musculus GN=Cyp2c54 PE=1 SV=1 | 13 | 105 | 5.0E-08 |
| sp|Q54SV9|C515B_DICDI | Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 | 9 | 159 | 6.0E-08 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 19 | 107 | 6.0E-08 |
| sp|O64900|C80B2_ESCCA | (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 | 36 | 118 | 6.0E-08 |
| sp|Q29473|CP2DF_CANLF | Cytochrome P450 2D15 OS=Canis lupus familiaris GN=CYP2D15 PE=1 SV=3 | 1 | 106 | 7.0E-08 |
| sp|P58050|C71BD_ARATH | Cytochrome P450 71B13 OS=Arabidopsis thaliana GN=CYP71B13 PE=2 SV=1 | 12 | 105 | 7.0E-08 |
| sp|Q54Q53|C519B_DICDI | Probable cytochrome P450 519B1 OS=Dictyostelium discoideum GN=cyp519B1 PE=3 SV=1 | 19 | 107 | 7.0E-08 |
| sp|P12938|CP2D3_RAT | Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 | 13 | 114 | 7.0E-08 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 6 | 119 | 7.0E-08 |
| sp|Q9LTM6|C71BH_ARATH | Cytochrome P450 71B17 OS=Arabidopsis thaliana GN=CYP71B17 PE=3 SV=1 | 29 | 122 | 8.0E-08 |
| sp|P58051|C71BE_ARATH | Cytochrome P450 71B14 OS=Arabidopsis thaliana GN=CYP71B14 PE=2 SV=1 | 36 | 106 | 8.0E-08 |
| sp|Q16678|CP1B1_HUMAN | Cytochrome P450 1B1 OS=Homo sapiens GN=CYP1B1 PE=1 SV=2 | 38 | 108 | 8.0E-08 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 6 | 119 | 9.0E-08 |
| sp|P58045|C71AE_ARATH | Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 | 27 | 172 | 9.0E-08 |
| sp|P19100|CP17A_PIG | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Sus scrofa GN=CYP17A1 PE=2 SV=3 | 35 | 154 | 9.0E-08 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 39 | 197 | 9.0E-08 |
| sp|P51590|CP2J3_RAT | Cytochrome P450 2J3 OS=Rattus norvegicus GN=Cyp2j3 PE=2 SV=1 | 32 | 118 | 1.0E-07 |
| sp|P56655|CP238_MOUSE | Cytochrome P450 2C38 OS=Mus musculus GN=Cyp2c38 PE=2 SV=2 | 25 | 162 | 1.0E-07 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 22 | 208 | 1.0E-07 |
| sp|Q54KV0|C513B_DICDI | Probable cytochrome P450 513B1 OS=Dictyostelium discoideum GN=cyp513B1 PE=3 SV=1 | 39 | 86 | 1.0E-07 |
| sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 35 | 107 | 1.0E-07 |
| sp|P56654|CP237_MOUSE | Cytochrome P450 2C37 OS=Mus musculus GN=Cyp2c37 PE=1 SV=2 | 13 | 108 | 1.0E-07 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 25 | 123 | 2.0E-07 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 36 | 202 | 2.0E-07 |
| sp|P05179|CP2C7_RAT | Cytochrome P450 2C7 OS=Rattus norvegicus GN=Cyp2c7 PE=1 SV=2 | 25 | 123 | 2.0E-07 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 3 | 107 | 2.0E-07 |
| sp|Q92039|CP1A1_CHACA | Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 | 3 | 152 | 2.0E-07 |
| sp|Q9CA61|C98A8_ARATH | Cytochrome P450 98A8 OS=Arabidopsis thaliana GN=CYP98A8 PE=1 SV=1 | 35 | 97 | 2.0E-07 |
| sp|P56657|CP240_MOUSE | Cytochrome P450 2C40 OS=Mus musculus GN=Cyp2c40 PE=1 SV=2 | 19 | 105 | 2.0E-07 |
| sp|O22203|C98A3_ARATH | Cytochrome P450 98A3 OS=Arabidopsis thaliana GN=CYP98A3 PE=1 SV=1 | 11 | 207 | 2.0E-07 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 25 | 123 | 2.0E-07 |
| sp|Q9STL1|C71AM_ARATH | Cytochrome P450 71A22 OS=Arabidopsis thaliana GN=CYP71A22 PE=2 SV=1 | 33 | 115 | 2.0E-07 |
| sp|O65784|C71B5_ARATH | Cytochrome P450 71B5 OS=Arabidopsis thaliana GN=CYP71B5 PE=2 SV=1 | 38 | 200 | 2.0E-07 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 35 | 148 | 2.0E-07 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 38 | 200 | 2.0E-07 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 35 | 148 | 2.0E-07 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 35 | 148 | 2.0E-07 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 35 | 148 | 2.0E-07 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 19 | 107 | 2.0E-07 |
| sp|Q54SN0|C513E_DICDI | Probable cytochrome P450 513E1 OS=Dictyostelium discoideum GN=cyp513E1 PE=3 SV=1 | 28 | 105 | 2.0E-07 |
| sp|Q9LTL8|C71BO_ARATH | Cytochrome P450 71B24 OS=Arabidopsis thaliana GN=CYP71B24 PE=2 SV=1 | 17 | 160 | 3.0E-07 |
| sp|Q93ZB2|KO1_ARATH | Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 | 39 | 165 | 3.0E-07 |
| sp|P04799|CP1A2_RAT | Cytochrome P450 1A2 OS=Rattus norvegicus GN=Cyp1a2 PE=1 SV=2 | 13 | 118 | 3.0E-07 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 36 | 119 | 3.0E-07 |
| sp|Q6JZS3|CP1A1_ORYLA | Cytochrome P450 1A1 OS=Oryzias latipes GN=cyp1a1 PE=3 SV=1 | 7 | 209 | 3.0E-07 |
| sp|Q6QNI4|C71AJ_AMMMJ | Psoralen synthase OS=Ammi majus GN=CYP71AJ1 PE=1 SV=1 | 36 | 123 | 4.0E-07 |
| sp|Q9LXM3|C71BZ_ARATH | Cytochrome P450 71B38 OS=Arabidopsis thaliana GN=CYP71B38 PE=2 SV=2 | 38 | 200 | 4.0E-07 |
| sp|Q29510|CP2CU_RABIT | Cytochrome P450 2C30 OS=Oryctolagus cuniculus GN=CYP2C30 PE=2 SV=1 | 38 | 105 | 4.0E-07 |
| sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 35 | 178 | 4.0E-07 |
| sp|P10632|CP2C8_HUMAN | Cytochrome P450 2C8 OS=Homo sapiens GN=CYP2C8 PE=1 SV=2 | 9 | 119 | 4.0E-07 |
| sp|P56656|CP239_MOUSE | Cytochrome P450 2C39 OS=Mus musculus GN=Cyp2c39 PE=1 SV=2 | 25 | 162 | 4.0E-07 |
| sp|Q9SCN2|C71BU_ARATH | Cytochrome P450 71B31 OS=Arabidopsis thaliana GN=CYP71B31 PE=2 SV=1 | 38 | 122 | 4.0E-07 |
| sp|Q91X77|CY250_MOUSE | Cytochrome P450 2C50 OS=Mus musculus GN=Cyp2c50 PE=1 SV=2 | 13 | 162 | 4.0E-07 |
| sp|P12939|CP2DA_RAT | Cytochrome P450 2D10 OS=Rattus norvegicus GN=Cyp2d10 PE=1 SV=1 | 13 | 152 | 5.0E-07 |
| sp|P79383|CP2E1_PIG | Cytochrome P450 2E1 OS=Sus scrofa GN=CYP2E1 PE=2 SV=1 | 38 | 119 | 5.0E-07 |
| sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 35 | 107 | 5.0E-07 |
| sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 35 | 107 | 5.0E-07 |
| sp|P79761|CP1A5_CHICK | Cytochrome P450 1A5 OS=Gallus gallus GN=CYP1A5 PE=2 SV=1 | 38 | 159 | 5.0E-07 |
| sp|Q9VW43|CP305_DROME | Probable cytochrome P450 305a1 OS=Drosophila melanogaster GN=Cyp305a1 PE=2 SV=1 | 9 | 110 | 5.0E-07 |
| sp|P24453|CP1A2_MESAU | Cytochrome P450 1A2 OS=Mesocricetus auratus GN=CYP1A2 PE=1 SV=4 | 1 | 118 | 6.0E-07 |
| sp|P24470|CP2CN_RAT | Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 | 13 | 105 | 6.0E-07 |
| sp|Q00557|CP1A1_MESAU | Cytochrome P450 1A1 OS=Mesocricetus auratus GN=CYP1A1 PE=2 SV=2 | 13 | 118 | 6.0E-07 |
| sp|P00186|CP1A2_MOUSE | Cytochrome P450 1A2 OS=Mus musculus GN=Cyp1a2 PE=1 SV=1 | 13 | 118 | 6.0E-07 |
| sp|P00185|CP1A1_RAT | Cytochrome P450 1A1 OS=Rattus norvegicus GN=Cyp1a1 PE=1 SV=1 | 13 | 118 | 6.0E-07 |
| sp|Q91W64|CP270_MOUSE | Cytochrome P450 2C70 OS=Mus musculus GN=Cyp2c70 PE=1 SV=2 | 9 | 125 | 6.0E-07 |
| sp|O81928|TCMO_CICAR | Trans-cinnamate 4-monooxygenase OS=Cicer arietinum GN=CYP73A19 PE=2 SV=2 | 38 | 219 | 7.0E-07 |
| sp|P15123|CP2CG_RABIT | Cytochrome P450 2C16 OS=Oryctolagus cuniculus GN=CYP2C16 PE=2 SV=1 | 25 | 123 | 7.0E-07 |
| sp|O18963|CP2E1_BOVIN | Cytochrome P450 2E1 OS=Bos taurus GN=CYP2E1 PE=2 SV=1 | 6 | 107 | 7.0E-07 |
| sp|P19225|CP270_RAT | Cytochrome P450 2C70 OS=Rattus norvegicus GN=Cyp2c70 PE=2 SV=1 | 9 | 105 | 7.0E-07 |
| sp|Q9LTL2|C71BP_ARATH | Cytochrome P450 71B25 OS=Arabidopsis thaliana GN=CYP71B25 PE=2 SV=1 | 36 | 148 | 8.0E-07 |
| sp|Q9LVD2|C71BA_ARATH | Cytochrome P450 71B10 OS=Arabidopsis thaliana GN=CYP71B10 PE=3 SV=1 | 27 | 106 | 8.0E-07 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 35 | 116 | 8.0E-07 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 36 | 115 | 9.0E-07 |
| sp|P33260|CP2CI_HUMAN | Cytochrome P450 2C18 OS=Homo sapiens GN=CYP2C18 PE=1 SV=3 | 38 | 123 | 9.0E-07 |
| sp|O35293|CP2F2_RAT | Cytochrome P450 2F2 OS=Rattus norvegicus GN=Cyp2f2 PE=2 SV=1 | 38 | 105 | 9.0E-07 |
| sp|P10610|CP2G1_RAT | Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 | 33 | 107 | 9.0E-07 |
| sp|O62671|CP241_CANLF | Cytochrome P450 2C41 OS=Canis lupus familiaris GN=CYP2C41 PE=2 SV=1 | 33 | 114 | 9.0E-07 |
| sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 38 | 200 | 1.0E-06 |
| sp|O57525|CP17A_RANDY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rana dybowskii GN=CYP17A1 PE=2 SV=1 | 25 | 152 | 1.0E-06 |
| sp|Q9LIP4|C71BX_ARATH | Cytochrome P450 71B36 OS=Arabidopsis thaliana GN=CYP71B36 PE=3 SV=1 | 38 | 200 | 1.0E-06 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 35 | 107 | 1.0E-06 |
| sp|Q9SAE3|C71BS_ARATH | Cytochrome P450 71B28 OS=Arabidopsis thaliana GN=CYP71B28 PE=2 SV=1 | 33 | 207 | 1.0E-06 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 35 | 107 | 1.0E-06 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 18 | 106 | 1.0E-06 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 32 | 202 | 1.0E-06 |
| sp|P33262|CP2CK_MACFA | Cytochrome P450 2C20 OS=Macaca fascicularis GN=CYP2C20 PE=2 SV=1 | 13 | 105 | 2.0E-06 |
| sp|Q1PS23|AMO_ARTAN | Amorpha-4,11-diene 12-monooxygenase OS=Artemisia annua GN=CYP71AV1 PE=1 SV=1 | 14 | 200 | 2.0E-06 |
| sp|P33261|CP2CJ_HUMAN | Cytochrome P450 2C19 OS=Homo sapiens GN=CYP2C19 PE=1 SV=3 | 24 | 123 | 2.0E-06 |
| sp|D5JBW9|GAO_SAUCO | Germacrene A oxidase OS=Saussurea costus PE=1 SV=1 | 14 | 200 | 2.0E-06 |
| sp|O73853|CP17A_ICTPU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ictalurus punctatus GN=cyp17a1 PE=2 SV=1 | 38 | 152 | 3.0E-06 |
| sp|P48522|TCMO_CATRO | Trans-cinnamate 4-monooxygenase OS=Catharanthus roseus GN=CYP73A4 PE=2 SV=1 | 27 | 219 | 3.0E-06 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 32 | 105 | 3.0E-06 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 24 | 143 | 3.0E-06 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 39 | 152 | 3.0E-06 |
| sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 38 | 208 | 3.0E-06 |
| sp|P10633|CP2D1_RAT | Cytochrome P450 2D1 OS=Rattus norvegicus GN=Cyp2d1 PE=2 SV=1 | 13 | 106 | 3.0E-06 |
| sp|Q9VWR5|CP306_DROME | Cytochrome P450 306a1 OS=Drosophila melanogaster GN=phm PE=1 SV=1 | 3 | 116 | 3.0E-06 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 32 | 152 | 4.0E-06 |
| sp|Q9XHE8|C71DI_MENSP | Cytochrome P450 71D18 OS=Mentha spicata GN=CYP71D18 PE=1 SV=1 | 1 | 200 | 4.0E-06 |
| sp|Q6WKZ1|C71DI_MENGR | Cytochrome P450 71D18 OS=Mentha gracilis GN=CYP71D18 PE=1 SV=1 | 1 | 200 | 4.0E-06 |
| sp|Q9FXW4|C80B2_COPJA | Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 | 33 | 105 | 4.0E-06 |
| sp|H2DH22|C7A10_PANGI | Cytochrome P450 CYP73A100 OS=Panax ginseng PE=2 SV=1 | 35 | 147 | 4.0E-06 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 35 | 106 | 5.0E-06 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 13 | 107 | 5.0E-06 |
| sp|O55071|CP2BJ_MOUSE | Cytochrome P450 2B19 OS=Mus musculus GN=Cyp2b19 PE=2 SV=1 | 35 | 105 | 5.0E-06 |
| sp|Q92110|CP1A1_ONCMY | Cytochrome P450 1A1 OS=Oncorhynchus mykiss GN=cyp1a1 PE=2 SV=2 | 39 | 202 | 5.0E-06 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 13 | 110 | 5.0E-06 |
| sp|P20814|CP2CD_RAT | Cytochrome P450 2C13, male-specific OS=Rattus norvegicus GN=Cyp2c13 PE=1 SV=1 | 38 | 114 | 6.0E-06 |
| sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 13 | 110 | 6.0E-06 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 35 | 107 | 6.0E-06 |
| sp|P11712|CP2C9_HUMAN | Cytochrome P450 2C9 OS=Homo sapiens GN=CYP2C9 PE=1 SV=3 | 25 | 123 | 6.0E-06 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 35 | 105 | 7.0E-06 |
| sp|P05177|CP1A2_HUMAN | Cytochrome P450 1A2 OS=Homo sapiens GN=CYP1A2 PE=1 SV=3 | 13 | 208 | 7.0E-06 |
| sp|Q92116|CP1A1_STECH | Cytochrome P450 1A1 OS=Stenotomus chrysops GN=cyp1a1 PE=2 SV=1 | 39 | 152 | 7.0E-06 |
| sp|Q64583|CP2BF_RAT | Cytochrome P450 2B15 OS=Rattus norvegicus GN=Cyp2b15 PE=3 SV=2 | 35 | 105 | 7.0E-06 |
| sp|O65788|C71B2_ARATH | Cytochrome P450 71B2 OS=Arabidopsis thaliana GN=CYP71B2 PE=2 SV=2 | 6 | 148 | 8.0E-06 |
| sp|O42231|CP1A1_LIZAU | Cytochrome P450 1A1 OS=Liza aurata GN=cyp1a1 PE=2 SV=1 | 7 | 152 | 9.0E-06 |
| sp|I3V6B1|C80BX_PAPSO | (S)-N-methylcoclaurine 3'-hydroxylase-like protein OS=Papaver somniferum GN=CYP80BX PE=2 SV=1 | 34 | 105 | 9.0E-06 |
| sp|Q9SAB6|C71AI_ARATH | Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 | 33 | 202 | 9.0E-06 |
| sp|P00184|CP1A1_MOUSE | Cytochrome P450 1A1 OS=Mus musculus GN=Cyp1a1 PE=1 SV=2 | 13 | 118 | 9.0E-06 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 11 | 213 | 9.0E-06 |
| sp|P00178|CP2B4_RABIT | Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 | 38 | 115 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0016491 | oxidoreductase activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.5 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 10 | 27 | 17 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|2756 MGVETTSVLQAWMALAIAMLSLVVWRVNRIGRRPANYPPGPPTLPLIGNLHQMPKANGHLQFQKWAREYGPVYSL MLGPKVMVVLSSDVAVKDLLDKRSAIYSSRPEFYLAQTILSRGLRPLFMVRQYIPFLSSKEYGSMVRMVRKLAHS VLNVTVARSYVPYQDLEIKAMLMGLLDSPESFINHIRRYTTSLTTQMAFGYRTPTSEDPNLIEMFDGAR* |
| Coding | >Hirsu2|2756 ATGGGCGTGGAAACGACGTCTGTGCTCCAGGCTTGGATGGCCCTGGCCATAGCCATGCTCAGCTTGGTAGTCTGG CGAGTCAACAGGATCGGGCGGCGTCCCGCGAACTATCCGCCGGGGCCTCCGACCTTGCCTCTCATCGGAAATCTT CACCAGATGCCCAAGGCCAACGGGCATCTGCAGTTCCAGAAATGGGCACGGGAGTACGGGCCGGTGTATTCGCTC ATGCTGGGGCCCAAGGTCATGGTCGTCTTGTCGTCGGACGTGGCGGTCAAAGACCTGCTCGACAAGCGAAGTGCC ATCTACTCGTCGAGGCCGGAGTTCTATCTGGCACAGACGATCCTGAGCAGAGGCTTGCGGCCATTGTTCATGGTG CGCCAGTACATACCCTTTCTGAGCTCAAAGGAATACGGCAGCATGGTGCGTATGGTCCGCAAGCTTGCCCACAGC GTCCTGAACGTGACGGTTGCTCGAAGCTATGTACCGTACCAAGACCTGGAGATCAAAGCCATGTTGATGGGGCTT CTCGACAGTCCGGAAAGCTTCATCAATCACATACGTCGATACACAACGTCCCTGACCACACAGATGGCCTTTGGC TATCGTACGCCGACGAGCGAGGATCCGAACTTGATAGAGATGTTTGACGGAGCCAGGTGA |
| Transcript | >Hirsu2|2756 ATGGGCGTGGAAACGACGTCTGTGCTCCAGGCTTGGATGGCCCTGGCCATAGCCATGCTCAGCTTGGTAGTCTGG CGAGTCAACAGGATCGGGCGGCGTCCCGCGAACTATCCGCCGGGGCCTCCGACCTTGCCTCTCATCGGAAATCTT CACCAGATGCCCAAGGCCAACGGGCATCTGCAGTTCCAGAAATGGGCACGGGAGTACGGGCCGGTGTATTCGCTC ATGCTGGGGCCCAAGGTCATGGTCGTCTTGTCGTCGGACGTGGCGGTCAAAGACCTGCTCGACAAGCGAAGTGCC ATCTACTCGTCGAGGCCGGAGTTCTATCTGGCACAGACGATCCTGAGCAGAGGCTTGCGGCCATTGTTCATGGTG CGCCAGTACATACCCTTTCTGAGCTCAAAGGAATACGGCAGCATGGTGCGTATGGTCCGCAAGCTTGCCCACAGC GTCCTGAACGTGACGGTTGCTCGAAGCTATGTACCGTACCAAGACCTGGAGATCAAAGCCATGTTGATGGGGCTT CTCGACAGTCCGGAAAGCTTCATCAATCACATACGTCGATACACAACGTCCCTGACCACACAGATGGCCTTTGGC TATCGTACGCCGACGAGCGAGGATCCGAACTTGATAGAGATGTTTGACGGAGCCAGGTGA |
| Gene | >Hirsu2|2756 ATGGGCGTGGAAACGACGTCTGTGCTCCAGGCTTGGATGGCCCTGGCCATAGCCATGCTCAGCTTGGTAGTCTGG CGAGTCAACAGGATCGGGCGGCGTCCCGCGAACTATCCGCCGGGGCCTCCGACCTTGCCTCTCATCGGAAATCTT CACCAGATGCCCAAGGCCAACGGGCATCTGCAGTTCCAGAAATGGGCACGGGAGTACGGGCCGGTGTATTCGCTC ATGCTGGGGCCCAAGGTCATGGTCGTCTTGTCGTCGGACGTGGCGGTCAAAGACCTGCTCGACAAGCGAAGTGCC ATCTACTCGTCGAGGCCGGAGTTCTATCTGGCACAGACGATCCTGAGCAGAGGCTTGCGGCCATTGTTCATGGTG CGCCAGTACATACCCTTTCTGAGCTCAAAGGTGCGAGTCGGCGGGAGTTACGATGCCAAACTGACCGTGCTCGAA CATGAGGATGGCAGGAATACGGCAGCATGGTGCGTATGGTCCGCAAGCTTGCCCACAGCGTCCTGAACGTGACGG TTGCTCGAAGCTATGTACCGTACCAAGACCTGGAGATCAAAGCCATGTTGATGGGGCTTCTCGACAGTCCGGAAA GCTTCATCAATCACATACGTCGATACACAACGTCCCTGACCACACAGATGGCCTTTGGCTATCGTACGCCGACGA GCGAGGATCCGAACTTGATAGAGATGTTTGACGTGAGTGACAGACCTGTCGTTGAGTGGCGAACGGAATGTGTTG ACAAGACAGCGTAGAACTTCGAACGACTCTCCGAGCTTGCAGGGAGCCAGGTGA |