Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2755
Gene name
LocationContig_168:14436..14816
Strand-
Gene length (bp)380
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.1E-14 1 73
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 3.6E-09 1 73

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 69 2.0E-15
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 2 67 3.0E-14
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 4 69 8.0E-09
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 4 69 9.0E-09
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 4 69 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 1 69 2.0E-15
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 2 67 3.0E-14
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 4 69 8.0E-09
sp|P37059|DHB2_HUMAN Estradiol 17-beta-dehydrogenase 2 OS=Homo sapiens GN=HSD17B2 PE=1 SV=1 4 69 9.0E-09
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 4 69 3.0E-07
sp|Q1DNC5|MKAR_COCIM Very-long-chain 3-oxoacyl-CoA reductase OS=Coccidioides immitis (strain RS) GN=CIMG_08188 PE=3 SV=2 4 71 3.0E-07
sp|Q9BPW9|DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens GN=DHRS9 PE=1 SV=1 3 74 3.0E-06
sp|Q6CHP1|MKAR_YARLI Very-long-chain 3-oxoacyl-CoA reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A06787g PE=3 SV=1 25 75 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2755
MFDVNLFGPMQMVHHFHDMIIRAAGTIVNIGSIGGVVPASYNASKAALHHWSNTLRLEMSPFNVKVITVSSTIFS
MSSGF*
Coding >Hirsu2|2755
ATGTTCGACGTGAATCTGTTCGGCCCCATGCAAATGGTGCATCATTTCCACGACATGATCATCCGCGCAGCCGGA
ACGATCGTGAACATCGGCTCCATCGGAGGCGTTGTGCCAGCGTCTTACAACGCATCCAAGGCCGCGCTTCACCAC
TGGTCCAACACCCTCCGTCTCGAGATGTCTCCGTTCAACGTCAAGGTCATCACCGTAAGCTCGACGATCTTCTCC
ATGAGTTCTGGGTTCTGA
Transcript >Hirsu2|2755
ATGTTCGACGTGAATCTGTTCGGCCCCATGCAAATGGTGCATCATTTCCACGACATGATCATCCGCGCAGCCGGA
ACGATCGTGAACATCGGCTCCATCGGAGGCGTTGTGCCAGCGTCTTACAACGCATCCAAGGCCGCGCTTCACCAC
TGGTCCAACACCCTCCGTCTCGAGATGTCTCCGTTCAACGTCAAGGTCATCACCGTAAGCTCGACGATCTTCTCC
ATGAGTTCTGGGTTCTGA
Gene >Hirsu2|2755
ATGTTCGACGTGAATCTGTTCGGCCCCATGCAAATGGTGCATCATTTCCACGACATGATCATCCGCGCAGCCGGA
ACGATCGTGAACATCGGCTCCATCGGAGGCGTTGTGCCGTATGTGTACGGAGGTGGGTGCAGCAATTTTCCGAGT
ACTTCAAAGCCGATGCCGCGATGCTTTGGGTCTCTGACGCCCCTAGAGCGTCTTACAACGCATCCAAGGCCGCGC
TTCACCACTGGTCCAACACCCTCCGTCTCGAGATGTCTCCGTTCAAGTAAGTCCTCTATACCAGAGAGAAGCATC
CACGCTGCCGACTGACTGCCCCCAGCGTCAAGGTCATCACCGTAAGCTCGACGATCTTCTCCATGAGTTCTGGGT
TCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail