Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2749
Gene name
LocationContig_1679:1853..3229
Strand-
Gene length (bp)1376
Transcript length (bp)1242
Coding sequence length (bp)1242
Protein length (aa) 414

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10483 Elong_Iki1 Elongator subunit Iki1 2.6E-96 84 399

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94495|ELP5_SCHPO Elongator complex protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=iki1 PE=3 SV=1 81 385 7.0E-25
sp|P38874|ELP5_YEAST Elongator complex protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IKI1 PE=1 SV=1 72 397 8.0E-25

GO

GO Term Description Terminal node
GO:0033588 Elongator holoenzyme complex Yes
GO:0002098 tRNA wobble uridine modification Yes
GO:0009451 RNA modification No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0006399 tRNA metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034470 ncRNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044464 cell part No
GO:0002097 tRNA wobble base modification No
GO:0006400 tRNA modification No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008033 tRNA processing No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2749
LGAPNFTPHSTSPAITIIIIIIIIIIIGILHLCAFPRIAKEKTTTEISARDNKQHAADDGKGPAGPMAPGKASDS
HARSHSLILLQRLLNLRDGASPLTLILDDLEQTARPVLGEILARAKLSRRKVIFVSFATLGKPRHVDVFVKAAGR
DFKTVRNELMAHYPVLDPMQSRQGKGKTATTQQRAAVIIDSLNSLATAEPASLAASLSSILTPSVSLVGVYHADV
PIVLPRSFNEYEPPALAMLCYLATAVLRLSSLPQEMERQKARDRALVEPEWGLREGREGAIVGLRPRMPGDDGRG
VVIDMELRRRSGRPVTEKFILTPGAPGKMALLTDHAMFARPEPTEAAAGGDGDVEDGPRSTFDLGLTDKQRRDRE
GVVLPYFDAQTDIGGGEGGRILYDMGREDDFDDEDDED*
Coding >Hirsu2|2749
CTGGGGGCACCGAATTTTACGCCTCACTCAACCTCGCCCGCCATCACCATCATCATCATCATCATCATCATCATC
ATCATCGGAATACTACACCTCTGCGCATTTCCTCGTATCGCCAAGGAGAAAACTACGACGGAGATCAGCGCGCGC
GACAACAAACAGCACGCGGCGGATGACGGCAAAGGGCCGGCAGGTCCCATGGCGCCAGGCAAGGCGTCGGATTCC
CACGCCCGCTCTCACAGCCTGATCCTGCTGCAAAGGCTGCTGAACCTCCGCGACGGCGCCAGCCCGCTGACGCTG
ATACTCGACGACCTCGAGCAGACGGCTCGTCCAGTCTTGGGCGAGATTCTCGCCCGCGCAAAGCTATCCAGGCGA
AAGGTGATATTCGTCTCCTTTGCCACGCTCGGGAAGCCTCGCCATGTCGACGTCTTCGTCAAGGCGGCCGGGAGG
GACTTCAAAACGGTGAGGAACGAGCTGATGGCCCATTACCCAGTCCTGGATCCGATGCAGAGTCGGCAGGGCAAG
GGCAAGACGGCGACGACGCAGCAAAGGGCCGCGGTCATTATTGACTCGCTGAACAGCCTGGCGACGGCCGAACCG
GCGTCCCTGGCCGCATCGCTCTCGAGCATCCTGACGCCGTCGGTCTCGCTCGTGGGCGTCTACCACGCTGACGTG
CCCATCGTCCTGCCGCGCAGCTTCAACGAGTACGAGCCGCCGGCGCTGGCGATGCTCTGCTACCTCGCCACCGCC
GTCCTTCGCCTCTCCAGTCTGCCGCAGGAGATGGAGCGGCAGAAGGCGCGCGACCGGGCCCTGGTCGAGCCCGAG
TGGGGGCTGAGGGAAGGCCGCGAGGGCGCCATCGTCGGCCTCCGACCGCGCATGCCCGGCGACGACGGCCGCGGC
GTCGTCATCGACATGGAGCTGCGGCGCCGCAGCGGCCGCCCCGTGACCGAGAAGTTCATCCTGACGCCGGGCGCC
CCGGGCAAGATGGCGCTACTGACCGACCACGCCATGTTCGCCCGGCCCGAGCCGACCGAGGCTGCGGCGGGCGGA
GACGGCGACGTTGAAGACGGGCCGCGCAGCACCTTCGACCTCGGCCTCACGGACAAGCAGCGGCGCGACAGGGAG
GGCGTCGTGCTGCCTTACTTTGATGCCCAGACGGACATTGGCGGCGGCGAGGGCGGCAGGATCCTGTACGACATG
GGGCGTGAGGACGACTTTGATGACGAGGACGACGAGGACTGA
Transcript >Hirsu2|2749
CTGGGGGCACCGAATTTTACGCCTCACTCAACCTCGCCCGCCATCACCATCATCATCATCATCATCATCATCATC
ATCATCGGAATACTACACCTCTGCGCATTTCCTCGTATCGCCAAGGAGAAAACTACGACGGAGATCAGCGCGCGC
GACAACAAACAGCACGCGGCGGATGACGGCAAAGGGCCGGCAGGTCCCATGGCGCCAGGCAAGGCGTCGGATTCC
CACGCCCGCTCTCACAGCCTGATCCTGCTGCAAAGGCTGCTGAACCTCCGCGACGGCGCCAGCCCGCTGACGCTG
ATACTCGACGACCTCGAGCAGACGGCTCGTCCAGTCTTGGGCGAGATTCTCGCCCGCGCAAAGCTATCCAGGCGA
AAGGTGATATTCGTCTCCTTTGCCACGCTCGGGAAGCCTCGCCATGTCGACGTCTTCGTCAAGGCGGCCGGGAGG
GACTTCAAAACGGTGAGGAACGAGCTGATGGCCCATTACCCAGTCCTGGATCCGATGCAGAGTCGGCAGGGCAAG
GGCAAGACGGCGACGACGCAGCAAAGGGCCGCGGTCATTATTGACTCGCTGAACAGCCTGGCGACGGCCGAACCG
GCGTCCCTGGCCGCATCGCTCTCGAGCATCCTGACGCCGTCGGTCTCGCTCGTGGGCGTCTACCACGCTGACGTG
CCCATCGTCCTGCCGCGCAGCTTCAACGAGTACGAGCCGCCGGCGCTGGCGATGCTCTGCTACCTCGCCACCGCC
GTCCTTCGCCTCTCCAGTCTGCCGCAGGAGATGGAGCGGCAGAAGGCGCGCGACCGGGCCCTGGTCGAGCCCGAG
TGGGGGCTGAGGGAAGGCCGCGAGGGCGCCATCGTCGGCCTCCGACCGCGCATGCCCGGCGACGACGGCCGCGGC
GTCGTCATCGACATGGAGCTGCGGCGCCGCAGCGGCCGCCCCGTGACCGAGAAGTTCATCCTGACGCCGGGCGCC
CCGGGCAAGATGGCGCTACTGACCGACCACGCCATGTTCGCCCGGCCCGAGCCGACCGAGGCTGCGGCGGGCGGA
GACGGCGACGTTGAAGACGGGCCGCGCAGCACCTTCGACCTCGGCCTCACGGACAAGCAGCGGCGCGACAGGGAG
GGCGTCGTGCTGCCTTACTTTGATGCCCAGACGGACATTGGCGGCGGCGAGGGCGGCAGGATCCTGTACGACATG
GGGCGTGAGGACGACTTTGATGACGAGGACGACGAGGACTGA
Gene >Hirsu2|2749
CTGGGGGCACCGAATTTTACGCCTCACTCAACCTCGCCCGCCATCACCATCATCATCATCATCATCATCATCATC
ATCATCGGAATACTACACCTCTGCGCATTTCCTCGTATCGCCAAGGAGAAAACTACGACGGAGATCAGCGCGCGC
GACAACAAACAGCACGCGGCGGATGACGGCAAAGGGCCGGCAGGTCCCATGGCGCCAGGCAAGGCGTCGGATTCC
CACGCCCGCTCTCACAGCCTGATCCTGCTGCAAAGGCTGCTGAACCTCCGCGACGGCGCCAGCCCGCTGACGCTG
ATACTCGACGACCTCGAGCAGACGGCTCGTCCAGTCTTGGGCGAGATTCTCGCCCGCGCAAAGGTGCGCCGACAT
TTCGATCCGAGGAGAGAGAGATGCTAAACGGTTCTGGCCGCAGCTATCCAGGCGAAAGGTGATATTCGTCTCCTT
TGCCACGCTCGGGAAGCCTCGCCATGTCGACGTCTTCGTCAAGGCGGCCGGGAGGGACTTCAAAACGGTGAGGAA
CGAGCTGATGGCCCATTACCCAGTCCTGGATCCGATGCAGAGTCGGCAGGGCAAGGGCAAGACGGCGACGACGCA
GCAAAGTAGCCCCCCCCCCCCCGTCCGTGTGCCCGGATATAGGGCGGCTTGCCGGACCGGCCGGAAGCTGACCTG
CGTTGGCAGGGGCCGCGGTCATTATTGACTCGCTGAACAGCCTGGCGACGGCCGAACCGGCGTCCCTGGCCGCAT
CGCTCTCGAGCATCCTGACGCCGTCGGTCTCGCTCGTGGGCGTCTACCACGCTGACGTGCCCATCGTCCTGCCGC
GCAGCTTCAACGAGTACGAGCCGCCGGCGCTGGCGATGCTCTGCTACCTCGCCACCGCCGTCCTTCGCCTCTCCA
GTCTGCCGCAGGAGATGGAGCGGCAGAAGGCGCGCGACCGGGCCCTGGTCGAGCCCGAGTGGGGGCTGAGGGAAG
GCCGCGAGGGCGCCATCGTCGGCCTCCGACCGCGCATGCCCGGCGACGACGGCCGCGGCGTCGTCATCGACATGG
AGCTGCGGCGCCGCAGCGGCCGCCCCGTGACCGAGAAGTTCATCCTGACGCCGGGCGCCCCGGGCAAGATGGCGC
TACTGACCGACCACGCCATGTTCGCCCGGCCCGAGCCGACCGAGGCTGCGGCGGGCGGAGACGGCGACGTTGAAG
ACGGGCCGCGCAGCACCTTCGACCTCGGCCTCACGGACAAGCAGCGGCGCGACAGGGAGGGCGTCGTGCTGCCTT
ACTTTGATGCCCAGACGGACATTGGCGGCGGCGAGGGCGGCAGGATCCTGTACGACATGGGGCGTGAGGACGACT
TTGATGACGAGGACGACGAGGACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail