Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2731
Gene name
LocationContig_167:28429..29497
Strand+
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01501 Glyco_transf_8 Glycosyl transferase family 8 1.8E-06 98 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09680|YA0C_SCHPO Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5H10.12c PE=4 SV=1 83 337 6.0E-22
sp|O43062|YGT9_SCHPO Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.09 PE=4 SV=1 72 327 1.0E-17
sp|O43061|MU136_SCHPO Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug136 PE=1 SV=1 61 347 9.0E-17
sp|O22893|GOLS1_ARATH Galactinol synthase 1 OS=Arabidopsis thaliana GN=GOLS1 PE=1 SV=1 116 298 1.0E-07
sp|Q5UNW1|YR707_MIMIV Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R707 PE=4 SV=1 82 193 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09680|YA0C_SCHPO Uncharacterized protein C5H10.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC5H10.12c PE=4 SV=1 83 337 6.0E-22
sp|O43062|YGT9_SCHPO Uncharacterized protein C4C3.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.09 PE=4 SV=1 72 327 1.0E-17
sp|O43061|MU136_SCHPO Meiotically up-regulated gene 136 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug136 PE=1 SV=1 61 347 9.0E-17
sp|O22893|GOLS1_ARATH Galactinol synthase 1 OS=Arabidopsis thaliana GN=GOLS1 PE=1 SV=1 116 298 1.0E-07
sp|Q5UNW1|YR707_MIMIV Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R707 PE=4 SV=1 82 193 3.0E-07
sp|C7G304|GOLS2_SOLLC Galactinol synthase 2 OS=Solanum lycopersicum GN=GOLS2 PE=2 SV=1 116 290 6.0E-07
sp|Q9FXB2|GOLS2_ARATH Galactinol synthase 2 OS=Arabidopsis thaliana GN=GOLS2 PE=1 SV=1 108 290 2.0E-06
sp|Q9XGN3|GOLS2_AJURE Galactinol synthase 2 (Fragment) OS=Ajuga reptans GN=GOLS2 PE=1 SV=1 116 292 7.0E-06
sp|Q8H1S1|GOLS6_ARATH Galactinol synthase 6 OS=Arabidopsis thaliana GN=GOLS6 PE=2 SV=1 116 289 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 transferase activity, transferring glycosyl groups Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2731
MLPLSSSHCQSAFSFLQRLLFTVGIYRNVRIVFFLSLFFFLVFTFTYRFVGNEPSWRRAGAFGAADRYAITTLLG
ENTSPNGEDGYFLATRVLTYQLLHAHETRISERNRHRIDWVVMVTAKVSQESRQQLEKDGAIVVQADDVEVPTWA
TTSEPRWKDVYTKLRVFQWTQYARVLFIDADAMITRPIDGIFEDPDAKQSKPPIRDRQVPDEMPYPAKYLLLARP
DNANRLAFNHAVPPDPNTPSDHLNSGFFMIEPSLEMFNHLLHVISIEGRYDSFMPEQNLFNYVFRRDGPMPWVEL
DWRWHSNFPNVQDRNAGVASLHEKLWQGGAPELRALWDSIRKRMEDYDQGKASYK*
Coding >Hirsu2|2731
ATGTTGCCACTGAGCTCCAGCCATTGCCAGTCGGCCTTCTCCTTCCTCCAGCGGCTGCTCTTTACCGTGGGGATA
TATAGGAATGTCCGGATCGTCTTCTTCTTATCGCTCTTTTTCTTCCTGGTCTTCACTTTCACCTACAGGTTCGTC
GGCAACGAGCCCTCCTGGCGACGCGCCGGCGCCTTCGGGGCGGCAGACCGATATGCCATCACGACCTTACTTGGG
GAGAACACGTCGCCCAATGGGGAAGACGGCTACTTTCTCGCGACGAGGGTCCTGACCTACCAGCTCCTCCACGCC
CACGAAACGCGCATCAGCGAGCGCAACCGCCACCGCATAGACTGGGTCGTCATGGTGACCGCCAAAGTGAGCCAG
GAGTCGCGCCAGCAGCTCGAGAAGGACGGCGCCATCGTCGTGCAGGCCGATGATGTCGAGGTTCCCACATGGGCC
ACGACGAGCGAGCCGCGGTGGAAAGACGTATACACAAAACTGCGCGTCTTTCAATGGACCCAGTATGCCCGTGTC
CTCTTTATCGACGCGGATGCCATGATCACGCGTCCCATCGACGGCATCTTCGAAGACCCCGACGCGAAGCAGTCC
AAGCCCCCCATCCGTGACCGACAGGTGCCGGACGAGATGCCGTACCCGGCAAAATACCTCCTGCTCGCCAGGCCC
GACAACGCGAATAGGCTCGCCTTCAACCACGCCGTGCCGCCAGACCCCAACACGCCGTCCGATCACCTGAACTCG
GGGTTCTTCATGATCGAGCCGTCGCTGGAGATGTTCAATCACCTCTTGCACGTCATCTCGATCGAAGGCCGCTAT
GACTCCTTCATGCCCGAGCAGAACCTTTTCAACTACGTCTTTCGCAGAGACGGGCCCATGCCCTGGGTGGAACTG
GACTGGCGGTGGCACAGTAACTTCCCCAACGTGCAGGACCGAAACGCCGGCGTCGCCTCACTCCATGAAAAGCTC
TGGCAGGGAGGAGCGCCCGAGCTGCGAGCTCTATGGGACAGCATCAGGAAAAGGATGGAGGATTATGACCAGGGA
AAAGCATCCTACAAGTAA
Transcript >Hirsu2|2731
ATGTTGCCACTGAGCTCCAGCCATTGCCAGTCGGCCTTCTCCTTCCTCCAGCGGCTGCTCTTTACCGTGGGGATA
TATAGGAATGTCCGGATCGTCTTCTTCTTATCGCTCTTTTTCTTCCTGGTCTTCACTTTCACCTACAGGTTCGTC
GGCAACGAGCCCTCCTGGCGACGCGCCGGCGCCTTCGGGGCGGCAGACCGATATGCCATCACGACCTTACTTGGG
GAGAACACGTCGCCCAATGGGGAAGACGGCTACTTTCTCGCGACGAGGGTCCTGACCTACCAGCTCCTCCACGCC
CACGAAACGCGCATCAGCGAGCGCAACCGCCACCGCATAGACTGGGTCGTCATGGTGACCGCCAAAGTGAGCCAG
GAGTCGCGCCAGCAGCTCGAGAAGGACGGCGCCATCGTCGTGCAGGCCGATGATGTCGAGGTTCCCACATGGGCC
ACGACGAGCGAGCCGCGGTGGAAAGACGTATACACAAAACTGCGCGTCTTTCAATGGACCCAGTATGCCCGTGTC
CTCTTTATCGACGCGGATGCCATGATCACGCGTCCCATCGACGGCATCTTCGAAGACCCCGACGCGAAGCAGTCC
AAGCCCCCCATCCGTGACCGACAGGTGCCGGACGAGATGCCGTACCCGGCAAAATACCTCCTGCTCGCCAGGCCC
GACAACGCGAATAGGCTCGCCTTCAACCACGCCGTGCCGCCAGACCCCAACACGCCGTCCGATCACCTGAACTCG
GGGTTCTTCATGATCGAGCCGTCGCTGGAGATGTTCAATCACCTCTTGCACGTCATCTCGATCGAAGGCCGCTAT
GACTCCTTCATGCCCGAGCAGAACCTTTTCAACTACGTCTTTCGCAGAGACGGGCCCATGCCCTGGGTGGAACTG
GACTGGCGGTGGCACAGTAACTTCCCCAACGTGCAGGACCGAAACGCCGGCGTCGCCTCACTCCATGAAAAGCTC
TGGCAGGGAGGAGCGCCCGAGCTGCGAGCTCTATGGGACAGCATCAGGAAAAGGATGGAGGATTATGACCAGGGA
AAAGCATCCTACAAGTAA
Gene >Hirsu2|2731
ATGTTGCCACTGAGCTCCAGCCATTGCCAGTCGGCCTTCTCCTTCCTCCAGCGGCTGCTCTTTACCGTGGGGATA
TATAGGAATGTCCGGATCGTCTTCTTCTTATCGCTCTTTTTCTTCCTGGTCTTCACTTTCACCTACAGGTTCGTC
GGCAACGAGCCCTCCTGGCGACGCGCCGGCGCCTTCGGGGCGGCAGACCGATATGCCATCACGACCTTACTTGGG
GAGAACACGTCGCCCAATGGGGAAGACGGCTACTTTCTCGCGACGAGGGTCCTGACCTACCAGCTCCTCCACGCC
CACGAAACGCGCATCAGCGAGCGCAACCGCCACCGCATAGACTGGGTCGTCATGGTGACCGCCAAAGTGAGCCAG
GAGTCGCGCCAGCAGCTCGAGAAGGACGGCGCCATCGTCGTGCAGGCCGATGATGTCGAGGTTCCCACATGGGCC
ACGACGAGCGAGCCGCGGTGGAAAGACGTATACACAAAACTGCGCGTCTTTCAATGGACCCAGTATGCCCGTGTC
CTCTTTATCGACGCGGATGCCATGATCACGCGTCCCATCGACGGCATCTTCGAAGACCCCGACGCGAAGCAGTCC
AAGCCCCCCATCCGTGACCGACAGGTGCCGGACGAGATGCCGTACCCGGCAAAATACCTCCTGCTCGCCAGGCCC
GACAACGCGAATAGGCTCGCCTTCAACCACGCCGTGCCGCCAGACCCCAACACGCCGTCCGATCACCTGAACTCG
GGGTTCTTCATGATCGAGCCGTCGCTGGAGATGTTCAATCACCTCTTGCACGTCATCTCGATCGAAGGCCGCTAT
GACTCCTTCATGCCCGAGCAGAACCTTTTCAACTACGTCTTTCGCAGAGACGGGCCCATGCCCTGGGTGGAACTG
GACTGGCGGTGGCACAGTAACTTCCCCAACGTGCAGGACCGAAACGCCGGCGTCGCCTCACTCCATGAAAAGCTC
TGGCAGGGAGGAGCGCCCGAGCTGCGAGCTCTATGGGACAGCATCAGGAAAAGGATGGAGGATTATGACCAGGGA
AAAGCATCCTACAAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail