Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2726
Gene name
LocationContig_167:10894..12005
Strand+
Gene length (bp)1111
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.3E-23 61 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 86 335 9.0E-11
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 61 266 3.0E-08
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 61 266 3.0E-08
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 67 257 7.0E-07
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 33 258 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 86 335 9.0E-11
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 61 266 3.0E-08
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 61 266 3.0E-08
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 67 257 7.0E-07
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 33 258 2.0E-06
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 33 258 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 90 112 22
3 119 138 19
4 144 166 22
5 179 201 22
6 211 230 19
7 251 273 22
8 283 302 19
9 315 337 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2726
MAANQTLVITPRTGSGPGTDSSIPLTYLENTSRTPSSENDSLASEVPRLQKTILVIQLSGVTFFCSVINGLVIIG
LPAISKDLELPSSLAFWPASVSGLATASSLLLTGSVTDAVGPRWVGSVGSFACGGLTIGAGVSRKGTELVAMRAL
QGVGLSLHLASSVALVTQVFPQGKSRNLAFSFLGLSQPFGFSVGLVLGGVLVDTVGWRVGWYISGASMLLLSFVG
LWAFPKGQDKRSFKEIVQDMKSKVDWVGAMLASSFMALLCYLLAVLSTDVYRIKEPGSITLLCLSTITLPCFLLW
VHRQVCRGKPALIPNSLWRNATFSSICVIIALSFAVINSMELFASLL*
Coding >Hirsu2|2726
ATGGCGGCAAATCAGACTCTCGTGATCACTCCTCGTACGGGCTCCGGACCCGGGACCGACAGCAGCATCCCGCTC
ACCTATTTGGAAAACACTAGTCGTACCCCGTCGTCCGAAAATGACTCACTGGCGTCTGAAGTGCCCAGGCTGCAG
AAGACTATCCTCGTGATCCAATTGAGCGGCGTCACGTTCTTCTGCAGCGTCATCAATGGTCTCGTCATCATCGGG
CTACCCGCTATCTCCAAGGACCTTGAACTGCCGTCGTCGTTGGCGTTTTGGCCCGCGTCAGTTTCCGGCCTCGCC
ACGGCCTCGTCGCTGCTGCTTACCGGCTCCGTGACCGACGCGGTGGGGCCCCGCTGGGTCGGCTCCGTCGGATCG
TTCGCCTGCGGGGGCCTGACCATTGGGGCCGGCGTTTCAAGGAAGGGCACCGAACTGGTTGCCATGAGAGCTTTG
CAGGGGGTTGGCCTCTCGCTGCATCTCGCGTCGTCCGTCGCTCTCGTCACCCAGGTTTTCCCACAAGGGAAGAGT
CGCAACTTGGCATTCTCGTTTCTCGGCCTCAGCCAGCCGTTTGGCTTCTCTGTCGGCCTTGTGCTGGGCGGCGTG
CTCGTTGACACTGTCGGCTGGCGAGTGGGGTGGTATATCTCTGGTGCCTCGATGCTTCTGCTTTCCTTTGTCGGC
TTGTGGGCGTTTCCCAAGGGCCAGGATAAGCGTTCGTTCAAGGAGATCGTGCAGGATATGAAAAGCAAGGTCGAC
TGGGTGGGGGCGATGCTTGCCTCTTCCTTCATGGCATTGCTATGCTACCTGCTGGCCGTTCTCAGCACGGATGTT
TATCGCATCAAGGAGCCAGGAAGCATTACTTTGCTCTGTTTGAGCACCATCACTTTGCCATGTTTCCTCCTCTGG
GTCCACCGCCAGGTCTGTCGCGGGAAACCGGCTCTTATTCCCAACTCACTCTGGCGAAACGCGACTTTCTCCAGC
ATCTGTGTGATTATCGCCTTGTCCTTTGCTGTCATCAACTCGATGGAGCTCTTCGCCAGTTTATTGTAA
Transcript >Hirsu2|2726
ATGGCGGCAAATCAGACTCTCGTGATCACTCCTCGTACGGGCTCCGGACCCGGGACCGACAGCAGCATCCCGCTC
ACCTATTTGGAAAACACTAGTCGTACCCCGTCGTCCGAAAATGACTCACTGGCGTCTGAAGTGCCCAGGCTGCAG
AAGACTATCCTCGTGATCCAATTGAGCGGCGTCACGTTCTTCTGCAGCGTCATCAATGGTCTCGTCATCATCGGG
CTACCCGCTATCTCCAAGGACCTTGAACTGCCGTCGTCGTTGGCGTTTTGGCCCGCGTCAGTTTCCGGCCTCGCC
ACGGCCTCGTCGCTGCTGCTTACCGGCTCCGTGACCGACGCGGTGGGGCCCCGCTGGGTCGGCTCCGTCGGATCG
TTCGCCTGCGGGGGCCTGACCATTGGGGCCGGCGTTTCAAGGAAGGGCACCGAACTGGTTGCCATGAGAGCTTTG
CAGGGGGTTGGCCTCTCGCTGCATCTCGCGTCGTCCGTCGCTCTCGTCACCCAGGTTTTCCCACAAGGGAAGAGT
CGCAACTTGGCATTCTCGTTTCTCGGCCTCAGCCAGCCGTTTGGCTTCTCTGTCGGCCTTGTGCTGGGCGGCGTG
CTCGTTGACACTGTCGGCTGGCGAGTGGGGTGGTATATCTCTGGTGCCTCGATGCTTCTGCTTTCCTTTGTCGGC
TTGTGGGCGTTTCCCAAGGGCCAGGATAAGCGTTCGTTCAAGGAGATCGTGCAGGATATGAAAAGCAAGGTCGAC
TGGGTGGGGGCGATGCTTGCCTCTTCCTTCATGGCATTGCTATGCTACCTGCTGGCCGTTCTCAGCACGGATGTT
TATCGCATCAAGGAGCCAGGAAGCATTACTTTGCTCTGTTTGAGCACCATCACTTTGCCATGTTTCCTCCTCTGG
GTCCACCGCCAGGTCTGTCGCGGGAAACCGGCTCTTATTCCCAACTCACTCTGGCGAAACGCGACTTTCTCCAGC
ATCTGTGTGATTATCGCCTTGTCCTTTGCTGTCATCAACTCGATGGAGCTCTTCGCCAGTTTATTGTAA
Gene >Hirsu2|2726
ATGGCGGCAAATCAGACTCTCGTGATCACTCCTCGTACGGGCTCCGGACCCGGGACCGACAGCAGCATCCCGCTC
ACCTATTTGGAAAACACTAGTCGTACCCCGTCGTCCGAAAATGACTCACTGGCGTCTGAAGTGCCCAGGCTGCAG
AAGACTATCCTCGTGATCCAATTGAGCGGCGTCACGTTCTTCTGCAGCGTCATCAATGGTCTCGTCATCATCGGG
CTACCCGCTATCTCCAAGGACCTTGAACTGCCGTCGTCGTTGGCGTTTTGGCCCGCGTCAGTTTCCGGCCTCGCC
ACGGCCTCGTCGCTGCTGCTTACCGGCTCCGTGACCGACGCGGTGGGGCCCCGCTGGGTCGGCTCCGTCGGATCG
TTCGCCTGCGGGGGCCTGACCATTGGGGCCGGCGTTTCAAGGAAGGGCACCGAACTGGTTGCCATGAGAGCTTTG
CAGGGGGTTGGCCTCTCGCTGCATCTCGCGTCGTCCGTCGCTCTCGTCACCCAGGTTTTCCCACAAGGGAAGAGT
CGCAACTTGGCATTCTCGTTTCTCGGCCTCAGCCAGCCGTTTGGCTTCTCTGTCGGCCTTGTGCTGGGCGGCGTG
CTCGTTGACACTGTCGGCTGGCGAGTGGGGTGGTATATCTCTGGTGCCTCGATGCTTCTGCTTTCCTTTGTCGGC
TTGTGGGCGTTTCCCAAGGGCCAGGATAAGCGTTCGTTCAAGGAGATCGTGCAGGATATGAAAAGCAAGGTCGAC
TGGGTGGGGGCGATGCTTGCCTCTTCCTTCATGGCATTGCTATGCTACCTGCTGGCGTTAGTTGAGCCCCTTCTA
CCACTATTCTACATTTATAAACGTTCGGAGGCTTACATACTTGGGCAGCGTTCTCAGCACGGATGTTTATCGCAT
CAAGGAGCCAGGAAGCATTACTTTGCTCTGTTTGAGCACCATCACTTTGCCATGTTTCCTCCTCTGGGTCCACCG
CCAGGTCTGTCGCGGGAAACCGGCTCTTATTCCCAACTCACTCTGGCGAAACGCGACTTTCTCCAGCATCTGTGT
GATTATCGCCTTGTCCTTTGCTGTCATCAACTCGATGGAGCTCTTCGCCAGTTTATTGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail