Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2703
Gene name
LocationContig_1658:2933..4057
Strand-
Gene length (bp)1124
Transcript length (bp)708
Coding sequence length (bp)708
Protein length (aa) 236

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04752 ChaC ChaC-like protein 2.8E-56 12 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87305|CHAC_SCHPO Glutathione-specific gamma-glutamylcyclotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.03 PE=3 SV=1 5 194 2.0E-48
sp|Q5PPV4|CHAC2_XENLA Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Xenopus laevis GN=chac2 PE=2 SV=1 12 196 3.0E-42
sp|Q4KMJ1|CHAC2_DANRE Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Danio rerio GN=chac2 PE=2 SV=1 12 203 3.0E-42
sp|Q8WUX2|CHAC2_HUMAN Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Homo sapiens GN=CHAC2 PE=2 SV=1 12 194 2.0E-41
sp|Q5ZI66|CHAC2_CHICK Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Gallus gallus GN=chac2 PE=2 SV=1 12 191 1.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87305|CHAC_SCHPO Glutathione-specific gamma-glutamylcyclotransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC31F10.03 PE=3 SV=1 5 194 2.0E-48
sp|Q5PPV4|CHAC2_XENLA Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Xenopus laevis GN=chac2 PE=2 SV=1 12 196 3.0E-42
sp|Q4KMJ1|CHAC2_DANRE Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Danio rerio GN=chac2 PE=2 SV=1 12 203 3.0E-42
sp|Q8WUX2|CHAC2_HUMAN Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Homo sapiens GN=CHAC2 PE=2 SV=1 12 194 2.0E-41
sp|Q5ZI66|CHAC2_CHICK Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Gallus gallus GN=chac2 PE=2 SV=1 12 191 1.0E-40
sp|Q641Z5|CHAC2_RAT Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Rattus norvegicus GN=Chac2 PE=2 SV=1 12 194 2.0E-40
sp|Q9CQG1|CHAC2_MOUSE Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Mus musculus GN=Chac2 PE=1 SV=1 12 194 3.0E-40
sp|P32656|CHAC_YEAST Glutathione-specific gamma-glutamylcyclotransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCG1 PE=1 SV=1 12 174 8.0E-38
sp|Q9BUX1|CHAC1_HUMAN Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Homo sapiens GN=CHAC1 PE=1 SV=2 12 208 2.0E-37
sp|B3STU3|CHAC1_RAT Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Rattus norvegicus GN=Chac1 PE=2 SV=1 12 198 3.0E-37
sp|Q8R3J5|CHAC1_MOUSE Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Mus musculus GN=Chac1 PE=1 SV=2 12 198 4.0E-37
sp|Q0IIH4|CHAC2_BOVIN Putative glutathione-specific gamma-glutamylcyclotransferase 2 OS=Bos taurus GN=CHAC2 PE=2 SV=1 12 194 3.0E-35
sp|Q5SPB6|CHAC1_DANRE Glutathione-specific gamma-glutamylcyclotransferase 1 OS=Danio rerio GN=chac1 PE=3 SV=1 12 189 1.0E-32
sp|P39163|CHAC_ECOLI Glutathione-specific gamma-glutamylcyclotransferase OS=Escherichia coli (strain K12) GN=chaC PE=3 SV=3 13 203 6.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0006751 glutathione catabolic process Yes
GO:0003839 gamma-glutamylcyclotransferase activity Yes
GO:1901575 organic substance catabolic process No
GO:0043171 peptide catabolic process No
GO:0003674 molecular_function No
GO:0043603 cellular amide metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0008150 biological_process No
GO:0006749 glutathione metabolic process No
GO:0044248 cellular catabolic process No
GO:0016829 lyase activity No
GO:0016840 carbon-nitrogen lyase activity No
GO:0008152 metabolic process No
GO:0006790 sulfur compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0006518 peptide metabolic process No
GO:0044273 sulfur compound catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0042219 cellular modified amino acid catabolic process No
GO:0016842 amidine-lyase activity No
GO:0003824 catalytic activity No
GO:0009056 catabolic process No
GO:0051187 cofactor catabolic process No
GO:0051186 cofactor metabolic process No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2703
MTAPTASESPEFWLYGYGSLIWKPPPHFDRRIPGWVTGYVRRFWQASEDHRGTPEAPGRVVTLIERSYWHGLADR
HHAAPDRVWGVAYRILPDRVAQVKAYLDIREINGYSIHHAPFHPADGSPPIRALVYIGTPDNAQFVGPQDPHRLA
RHILASRGPSGPNRDYLYNLRRALDGLGPGSGDAHVSDLADRVRAIDPDLDPDPDAGAPPPRPDPDAADFRRKSS
TSEAEEIEKA*
Coding >Hirsu2|2703
ATGACGGCCCCGACAGCCTCCGAAAGCCCCGAATTCTGGCTCTACGGCTACGGGAGTCTGATATGGAAGCCTCCG
CCGCACTTTGACAGGAGAATTCCCGGCTGGGTAACGGGCTACGTCCGACGATTCTGGCAGGCCAGCGAGGACCAC
CGCGGGACGCCCGAGGCCCCCGGCCGCGTCGTCACCCTCATCGAGCGCTCCTACTGGCACGGCCTGGCCGACCGC
CACCACGCCGCCCCGGACCGCGTCTGGGGCGTCGCCTACCGCATCCTGCCGGACCGCGTCGCCCAGGTCAAGGCC
TACCTCGACATCCGCGAGATCAACGGCTACTCCATCCACCACGCCCCCTTCCACCCGGCCGACGGCTCGCCGCCC
ATCCGCGCCCTCGTCTACATCGGCACCCCGGACAACGCCCAGTTCGTCGGCCCCCAGGACCCGCACCGCCTCGCC
CGCCACATCCTCGCCAGCCGCGGGCCCAGCGGCCCCAACCGCGACTACCTCTACAACCTCCGCCGCGCCCTCGAC
GGCCTCGGCCCGGGCAGCGGCGACGCCCATGTCAGCGACCTCGCCGACCGCGTCCGCGCCATCGACCCCGACCTC
GACCCCGACCCCGATGCCGGTGCCCCACCTCCCCGGCCCGACCCCGACGCCGCCGACTTTCGCCGCAAGAGCAGC
ACGTCCGAGGCCGAGGAGATCGAAAAGGCCTGA
Transcript >Hirsu2|2703
ATGACGGCCCCGACAGCCTCCGAAAGCCCCGAATTCTGGCTCTACGGCTACGGGAGTCTGATATGGAAGCCTCCG
CCGCACTTTGACAGGAGAATTCCCGGCTGGGTAACGGGCTACGTCCGACGATTCTGGCAGGCCAGCGAGGACCAC
CGCGGGACGCCCGAGGCCCCCGGCCGCGTCGTCACCCTCATCGAGCGCTCCTACTGGCACGGCCTGGCCGACCGC
CACCACGCCGCCCCGGACCGCGTCTGGGGCGTCGCCTACCGCATCCTGCCGGACCGCGTCGCCCAGGTCAAGGCC
TACCTCGACATCCGCGAGATCAACGGCTACTCCATCCACCACGCCCCCTTCCACCCGGCCGACGGCTCGCCGCCC
ATCCGCGCCCTCGTCTACATCGGCACCCCGGACAACGCCCAGTTCGTCGGCCCCCAGGACCCGCACCGCCTCGCC
CGCCACATCCTCGCCAGCCGCGGGCCCAGCGGCCCCAACCGCGACTACCTCTACAACCTCCGCCGCGCCCTCGAC
GGCCTCGGCCCGGGCAGCGGCGACGCCCATGTCAGCGACCTCGCCGACCGCGTCCGCGCCATCGACCCCGACCTC
GACCCCGACCCCGATGCCGGTGCCCCACCTCCCCGGCCCGACCCCGACGCCGCCGACTTTCGCCGCAAGAGCAGC
ACGTCCGAGGCCGAGGAGATCGAAAAGGCCTGA
Gene >Hirsu2|2703
ATGACGGCCCCGACAGCCTCCGAAAGCCCCGAATTCTGGCTCTACGGCTACGGGTCTGCTCTCTCGCCCGTGCCC
CGCCGCCTCCGCCCTCGTTCTGACGGACCCCCTCCCTCTCTTTCTGCACGGTTCAGGAGTCTGATATGGAAGCCT
CCGCCGCACTTTGGTAAATCCCCCGCCCTGCTCCAGCAAGACGAGAGAGACAGAGAGAGGTGTGATGAAGAGGTG
GATGCTGCACACACGCATATATACACATGTATATATATCGTATCTATCTACATCAACCCAGACTGACGTCTCTGC
CTCCCCTCCCCCCTCCGTCCTCGCATTTCGGCTGGGGCATCTACAGACAGGAGAATTCCCGGCTGGGTAACGGGC
TACGTCCGACGATTCTGGCAGGTCTGCGGCGAGATGCCCCCCCTCCCCTCCCATATCTGGCCAGACCATGCCCGG
CTCACGCACCGTCCAGGCCAGGTAGGCGGCCCTCCGGCTTGGCTCCCTTCCGGCCCGGCCGTTCCGCTGACGGAC
CGACGTCGGCCCTCGCGCCCCGCCCGAGAAGCGAGGACCACCGCGGGACGCCCGAGGCCCCCGGCCGCGTCGTCA
CCCTCATCGAGCGCTCCTACTGGCACGGCCTGGCCGACCGCCACCACGCCGCCCCGGACCGCGTCTGGGGCGTCG
CCTACCGCATCCTGCCGGACCGCGTCGCCCAGGTCAAGGCCTACCTCGACATCCGCGAGATCAACGGCTACTCCA
TCCACCACGCCCCCTTCCACCCGGCCGACGGCTCGCCGCCCATCCGCGCCCTCGTCTACATCGGCACCCCGGACA
ACGCCCAGTTCGTCGGCCCCCAGGACCCGCACCGCCTCGCCCGCCACATCCTCGCCAGCCGCGGGCCCAGCGGCC
CCAACCGCGACTACCTCTACAACCTCCGCCGCGCCCTCGACGGCCTCGGCCCGGGCAGCGGCGACGCCCATGTCA
GCGACCTCGCCGACCGCGTCCGCGCCATCGACCCCGACCTCGACCCCGACCCCGATGCCGGTGCCCCACCTCCCC
GGCCCGACCCCGACGCCGCCGACTTTCGCCGCAAGAGCAGCACGTCCGAGGCCGAGGAGATCGAAAAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail