Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2701
Gene name
LocationContig_1657:3150..4456
Strand+
Gene length (bp)1306
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00483 NTP_transferase Nucleotidyl transferase 3.4E-52 2 230
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 2.0E-06 253 280
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 1.4E-10 263 298
PF12804 NTP_transf_3 MobA-like NTP transferase domain 2.5E-09 3 137

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74624|MPG1_HYPJE Mannose-1-phosphate guanyltransferase OS=Hypocrea jecorina GN=mpg1 PE=1 SV=1 1 364 0.0E+00
sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|Q7RVR8|MPG1_NEUCR Mannose-1-phosphate guanyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpg-1 PE=3 SV=1 1 364 0.0E+00
sp|Q5B1J4|MPG1_EMENI Mannose-1-phosphate guanyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpg1 PE=3 SV=2 1 364 0.0E+00
sp|Q2UJU5|MPG1_ASPOR Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpg1 PE=3 SV=1 1 364 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74624|MPG1_HYPJE Mannose-1-phosphate guanyltransferase OS=Hypocrea jecorina GN=mpg1 PE=1 SV=1 1 364 0.0E+00
sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|Q7RVR8|MPG1_NEUCR Mannose-1-phosphate guanyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpg-1 PE=3 SV=1 1 364 0.0E+00
sp|Q5B1J4|MPG1_EMENI Mannose-1-phosphate guanyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpg1 PE=3 SV=2 1 364 0.0E+00
sp|Q2UJU5|MPG1_ASPOR Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpg1 PE=3 SV=1 1 364 0.0E+00
sp|Q4U3E8|MPG1_ASPFU Mannose-1-phosphate guanyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpg1 PE=2 SV=1 1 364 0.0E+00
sp|O74484|MPG1_SCHPO Mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpg1 PE=2 SV=1 1 364 0.0E+00
sp|O93827|MPG1_CANAL Mannose-1-phosphate guanyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPG1 PE=1 SV=1 1 364 0.0E+00
sp|Q9P8N0|MPG1_PICAN Mannose-1-phosphate guanyltransferase OS=Pichia angusta GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|Q6CCU3|MPG1_YARLI Mannose-1-phosphate guanyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|Q6BN12|MPG1_DEBHA Mannose-1-phosphate guanyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|P0CO20|MPG1_CRYNJ Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MPG1 PE=2 SV=1 1 364 0.0E+00
sp|P0CO21|MPG1_CRYNB Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|Q752H4|MPG1_ASHGO Mannose-1-phosphate guanyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPG1 PE=3 SV=1 1 364 0.0E+00
sp|Q70SJ2|MPG1_KLULA Mannose-1-phosphate guanyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPG1 PE=1 SV=1 1 364 0.0E+00
sp|P41940|MPG1_YEAST Mannose-1-phosphate guanyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSA1 PE=1 SV=2 1 364 0.0E+00
sp|Q9Y725|MPG11_CANGA Mannose-1-phosphate guanyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=1 SV=1 1 364 3.0E-179
sp|Q6FRY2|MPG12_CANGA Mannose-1-phosphate guanyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=3 SV=1 1 364 1.0E-175
sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 1 364 5.0E-165
sp|Q6DBU5|GMPPB_DANRE Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1 1 364 9.0E-165
sp|Q7JZB4|GMPPB_DROME Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1 2 364 3.0E-164
sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 1 364 6.0E-164
sp|A2VD83|GMPBB_XENLA Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-b PE=2 SV=1 1 364 7.0E-164
sp|Q295Y7|GMPPB_DROPS Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1 2 364 9.0E-164
sp|Q9Y5P6|GMPPB_HUMAN Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2 1 364 2.0E-160
sp|P0C5I2|GMPPB_PIG Mannose-1-phosphate guanyltransferase beta OS=Sus scrofa GN=GMPPB PE=1 SV=1 1 364 7.0E-160
sp|Q8BTZ7|GMPPB_MOUSE Mannose-1-phosphate guanyltransferase beta OS=Mus musculus GN=Gmppb PE=1 SV=1 1 364 2.0E-159
sp|Q2YDJ9|GMPPB_BOVIN Mannose-1-phosphate guanyltransferase beta OS=Bos taurus GN=GMPPB PE=2 SV=1 1 364 4.0E-159
sp|Q54K39|GMPPB_DICDI Mannose-1-phosphate guanyltransferase beta OS=Dictyostelium discoideum GN=gmppB PE=2 SV=1 1 364 8.0E-157
sp|Q6Z9A3|GMPP3_ORYSJ Probable mannose-1-phosphate guanylyltransferase 3 OS=Oryza sativa subsp. japonica GN=Os08g0237200 PE=2 SV=1 1 364 3.0E-156
sp|Q941T9|GMPP2_ORYSJ Probable mannose-1-phosphate guanylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os01g0847200 PE=2 SV=1 1 364 3.0E-155
sp|O22287|GMPP1_ARATH Mannose-1-phosphate guanylyltransferase 1 OS=Arabidopsis thaliana GN=CYT1 PE=1 SV=1 1 364 5.0E-155
sp|Q84JH5|GMPP1_ORYSJ Probable mannose-1-phosphate guanylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0268400 PE=2 SV=1 1 364 3.0E-154
sp|Q61S97|GMPPB_CAEBR Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis briggsae GN=tag-335 PE=3 SV=2 1 364 9.0E-147
sp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 2 OS=Arabidopsis thaliana GN=At3g55590 PE=2 SV=1 1 364 8.0E-146
sp|A3QMC8|GMPPB_CAEEL Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis elegans GN=tag-335 PE=3 SV=1 1 364 2.0E-144
sp|Q8H1Q7|GMPP3_ARATH Probable mannose-1-phosphate guanylyltransferase 3 OS=Arabidopsis thaliana GN=At4g30570 PE=2 SV=1 21 353 2.0E-121
sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 1 354 4.0E-58
sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=1 SV=1 1 354 1.0E-57
sp|I3LUP1|GMPPA_PIG Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa GN=GMPPA PE=1 SV=2 1 354 1.0E-57
sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 1 354 2.0E-57
sp|Q5XIC1|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1 1 354 1.0E-56
sp|Q0VFM6|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1 1 354 4.0E-56
sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 2 358 2.0E-55
sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 1 354 2.0E-55
sp|Q6GMK8|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1 1 353 3.0E-55
sp|Q6DKE9|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1 1 354 4.0E-55
sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 1 353 3.0E-52
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 1 357 7.0E-45
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 3 364 8.0E-44
sp|A4FX98|GLMU_METM5 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0513 PE=3 SV=1 1 319 1.0E-31
sp|A6VG23|GLMU_METM7 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0329 PE=3 SV=1 1 319 1.0E-30
sp|A6UP85|GLMU_METVS Bifunctional protein GlmU OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0399 PE=3 SV=1 1 319 5.0E-30
sp|D4GU70|AGL11_HALVD Low-salt glycan biosynthesis nucleotidyltransferase Agl11 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl11 PE=3 SV=1 1 319 2.0E-28
sp|A6UUQ4|GLMU_META3 Bifunctional protein GlmU OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0642 PE=3 SV=1 1 319 3.0E-27
sp|Q6LYB5|GLMU_METMP Bifunctional protein GlmU OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1076 PE=3 SV=1 1 319 5.0E-27
sp|Q58501|GLMU_METJA Bifunctional protein GlmU OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glmU PE=1 SV=1 1 319 9.0E-27
sp|Q8Z5I4|RFBF_SALTI Glucose-1-phosphate cytidylyltransferase OS=Salmonella typhi GN=rfbF PE=1 SV=1 1 241 4.0E-25
sp|P26396|RFBF_SALTY Glucose-1-phosphate cytidylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbF PE=3 SV=1 1 242 1.0E-24
sp|Q9AGY6|HDDC_ANETH D-glycero-alpha-D-manno-heptose 1-phosphate guanylyltransferase OS=Aneurinibacillus thermoaerophilus GN=hddC PE=1 SV=1 1 226 4.0E-23
sp|A0Q3I7|GLGC_CLONN Glucose-1-phosphate adenylyltransferase OS=Clostridium novyi (strain NT) GN=glgC PE=3 SV=1 1 350 1.0E-22
sp|B9K6N9|GLGC_THENN Glucose-1-phosphate adenylyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glgC PE=3 SV=1 3 340 2.0E-21
sp|Q2G0S3|GLMU_STAA8 Bifunctional protein GlmU OS=Staphylococcus aureus (strain NCTC 8325) GN=glmU PE=3 SV=1 4 338 2.0E-20
sp|Q8NXZ7|GLMU_STAAW Bifunctional protein GlmU OS=Staphylococcus aureus (strain MW2) GN=glmU PE=3 SV=1 4 338 3.0E-20
sp|Q6GBY9|GLMU_STAAS Bifunctional protein GlmU OS=Staphylococcus aureus (strain MSSA476) GN=glmU PE=3 SV=1 4 338 3.0E-20
sp|Q5HIH6|GLMU_STAAC Bifunctional protein GlmU OS=Staphylococcus aureus (strain COL) GN=glmU PE=3 SV=1 4 338 3.0E-20
sp|Q2FJE2|GLMU_STAA3 Bifunctional protein GlmU OS=Staphylococcus aureus (strain USA300) GN=glmU PE=3 SV=1 4 338 3.0E-20
sp|Q2YVU6|GLMU_STAAB Bifunctional protein GlmU OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glmU PE=3 SV=2 4 338 6.0E-20
sp|Q7A7B4|GLMU_STAAN Bifunctional protein GlmU OS=Staphylococcus aureus (strain N315) GN=glmU PE=1 SV=1 4 338 9.0E-20
sp|Q99WA4|GLMU_STAAM Bifunctional protein GlmU OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glmU PE=3 SV=1 4 338 9.0E-20
sp|B1L9R3|GLGC_THESQ Glucose-1-phosphate adenylyltransferase OS=Thermotoga sp. (strain RQ2) GN=glgC PE=3 SV=1 3 345 1.0E-19
sp|Q9WY82|GLGC_THEMA Glucose-1-phosphate adenylyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glgC PE=3 SV=1 3 345 1.0E-19
sp|Q6GJH2|GLMU_STAAR Bifunctional protein GlmU OS=Staphylococcus aureus (strain MRSA252) GN=glmU PE=3 SV=1 4 338 1.0E-19
sp|A5IKI1|GLGC_THEP1 Glucose-1-phosphate adenylyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glgC PE=3 SV=1 3 351 2.0E-19
sp|A4J0P6|GLMU_DESRM Bifunctional protein GlmU OS=Desulfotomaculum reducens (strain MI-1) GN=glmU PE=3 SV=1 1 352 3.0E-19
sp|A6TJM5|GLMU_ALKMQ Bifunctional protein GlmU OS=Alkaliphilus metalliredigens (strain QYMF) GN=glmU PE=3 SV=1 1 350 4.0E-19
sp|B1YGP5|GLMU_EXIS2 Bifunctional protein GlmU OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glmU PE=3 SV=1 4 342 5.0E-19
sp|P08075|RMLA_STRGR Glucose-1-phosphate thymidylyltransferase OS=Streptomyces griseus GN=strD PE=3 SV=1 1 332 1.0E-18
sp|Q18A75|GLGC_PEPD6 Glucose-1-phosphate adenylyltransferase OS=Peptoclostridium difficile (strain 630) GN=glgC PE=3 SV=1 1 342 1.0E-18
sp|Q6HPW8|GLMU_BACHK Bifunctional protein GlmU OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmU PE=3 SV=1 3 338 2.0E-18
sp|Q81J98|GLMU_BACCR Bifunctional protein GlmU OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmU PE=3 SV=1 3 338 3.0E-18
sp|B9IZD2|GLMU_BACCQ Bifunctional protein GlmU OS=Bacillus cereus (strain Q1) GN=glmU PE=3 SV=1 3 338 3.0E-18
sp|B7HPW0|GLMU_BACC7 Bifunctional protein GlmU OS=Bacillus cereus (strain AH187) GN=glmU PE=3 SV=1 3 338 3.0E-18
sp|B7HIL7|GLMU_BACC4 Bifunctional protein GlmU OS=Bacillus cereus (strain B4264) GN=glmU PE=3 SV=1 3 338 3.0E-18
sp|Q73FF9|GLMU_BACC1 Bifunctional protein GlmU OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmU PE=3 SV=1 3 338 3.0E-18
sp|B7ISV9|GLMU_BACC2 Bifunctional protein GlmU OS=Bacillus cereus (strain G9842) GN=glmU PE=3 SV=1 3 338 3.0E-18
sp|D4GYH1|AGLF_HALVD UTP--glucose-1-phosphate uridylyltransferase AglF OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglF PE=1 SV=1 1 225 3.0E-18
sp|Q63HI4|GLMU_BACCZ Bifunctional protein GlmU OS=Bacillus cereus (strain ZK / E33L) GN=glmU PE=3 SV=1 3 338 5.0E-18
sp|C1ESX9|GLMU_BACC3 Bifunctional protein GlmU OS=Bacillus cereus (strain 03BB102) GN=glmU PE=3 SV=1 3 338 5.0E-18
sp|B7JK56|GLMU_BACC0 Bifunctional protein GlmU OS=Bacillus cereus (strain AH820) GN=glmU PE=3 SV=1 3 338 5.0E-18
sp|Q81VZ1|GLMU_BACAN Bifunctional protein GlmU OS=Bacillus anthracis GN=glmU PE=3 SV=1 3 338 5.0E-18
sp|A0R8C1|GLMU_BACAH Bifunctional protein GlmU OS=Bacillus thuringiensis (strain Al Hakam) GN=glmU PE=3 SV=2 3 338 5.0E-18
sp|C3LJ22|GLMU_BACAC Bifunctional protein GlmU OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glmU PE=3 SV=1 3 338 5.0E-18
sp|C3P9J5|GLMU_BACAA Bifunctional protein GlmU OS=Bacillus anthracis (strain A0248) GN=glmU PE=3 SV=1 3 338 5.0E-18
sp|Q97E92|GLMU_CLOAB Bifunctional protein GlmU OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glmU PE=3 SV=1 4 338 5.0E-18
sp|Q899I9|GLMU_CLOTE Bifunctional protein GlmU OS=Clostridium tetani (strain Massachusetts / E88) GN=glmU PE=3 SV=1 3 338 8.0E-18
sp|Q181B4|GLMU_PEPD6 Bifunctional protein GlmU OS=Peptoclostridium difficile (strain 630) GN=glmU PE=3 SV=1 2 338 9.0E-18
sp|B7IFV2|GLGC_THEAB Glucose-1-phosphate adenylyltransferase OS=Thermosipho africanus (strain TCF52B) GN=glgC PE=3 SV=1 3 351 1.0E-17
sp|Q8E5V7|GLGC_STRA3 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glgC PE=3 SV=1 1 360 2.0E-17
sp|Q8DPS5|GLGC_STRR6 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgC PE=3 SV=1 1 344 3.0E-17
sp|Q04KG7|GLGC_STRP2 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgC PE=3 SV=1 1 344 3.0E-17
sp|Q1WV55|GLMU_LACS1 Bifunctional protein GlmU OS=Lactobacillus salivarius (strain UCC118) GN=glmU PE=3 SV=1 3 347 4.0E-17
sp|Q8CXP9|GLMU_OCEIH Bifunctional protein GlmU OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glmU PE=3 SV=1 3 353 4.0E-17
sp|A9VN62|GLMU_BACWK Bifunctional protein GlmU OS=Bacillus weihenstephanensis (strain KBAB4) GN=glmU PE=3 SV=1 3 338 4.0E-17
sp|Q8E080|GLGC_STRA5 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glgC PE=3 SV=1 1 344 4.0E-17
sp|Q3K1K4|GLGC_STRA1 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glgC PE=3 SV=1 1 344 4.0E-17
sp|B0KBF5|GLMU_THEP3 Bifunctional protein GlmU OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=glmU PE=3 SV=1 4 359 5.0E-17
sp|A7GJW1|GLMU_BACCN Bifunctional protein GlmU OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glmU PE=3 SV=1 4 338 5.0E-17
sp|Q3AFM0|GLMU_CARHZ Bifunctional protein GlmU OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=glmU PE=3 SV=1 1 352 6.0E-17
sp|B8G1G5|GLGC_DESHD Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glgC PE=3 SV=1 3 336 8.0E-17
sp|Q24VW5|GLGC_DESHY Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glgC PE=3 SV=1 3 336 8.0E-17
sp|P55253|RMLA3_ECOLX Glucose-1-phosphate thymidylyltransferase OS=Escherichia coli GN=rmlA PE=3 SV=1 2 255 1.0E-16
sp|Q6KHP5|GLGC_MYCMO Glucose-1-phosphate adenylyltransferase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=glgC PE=3 SV=1 1 318 1.0E-16
sp|Q8RHM3|GLMU_FUSNN Bifunctional protein GlmU OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glmU PE=3 SV=1 1 338 2.0E-16
sp|P55254|RMLA_SALAN Glucose-1-phosphate thymidylyltransferase OS=Salmonella anatum GN=rmlA PE=3 SV=1 2 255 2.0E-16
sp|A7HN65|GLGC_FERNB Glucose-1-phosphate adenylyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glgC PE=3 SV=1 3 348 2.0E-16
sp|Q8CMT0|GLMU_STAES Bifunctional protein GlmU OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glmU PE=3 SV=1 4 342 3.0E-16
sp|Q5HRQ6|GLMU_STAEQ Bifunctional protein GlmU OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glmU PE=3 SV=1 4 342 3.0E-16
sp|C0MH79|GLGC_STRS7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=glgC PE=3 SV=1 1 319 3.0E-16
sp|Q9KDX4|GLGC_BACHD Glucose-1-phosphate adenylyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glgC PE=3 SV=1 3 299 3.0E-16
sp|A6LJL4|GLGC_THEM4 Glucose-1-phosphate adenylyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glgC PE=3 SV=1 3 351 4.0E-16
sp|B5E4N4|GLGC_STRP4 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|B9DRS6|GLGC_STRU0 Glucose-1-phosphate adenylyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|P37779|RMLA1_SHIFL Glucose-1-phosphate thymidylyltransferase 1 OS=Shigella flexneri GN=rfbA PE=3 SV=2 2 247 5.0E-16
sp|C1CRM1|GLGC_STRZT Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|C1CKI5|GLGC_STRZP Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|C1CEA8|GLGC_STRZJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|Q97QS7|GLGC_STRPN Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|B8ZPW3|GLGC_STRPJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|B1IBQ8|GLGC_STRPI Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glgC PE=3 SV=1 1 344 5.0E-16
sp|B2IPY6|GLGC_STRPS Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=glgC PE=3 SV=1 1 344 6.0E-16
sp|Q5FL67|GLGC_LACAC Glucose-1-phosphate adenylyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glgC PE=3 SV=1 1 337 6.0E-16
sp|Q0B0S9|GLMU_SYNWW Bifunctional protein GlmU OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glmU PE=3 SV=1 1 347 6.0E-16
sp|P37744|RMLA1_ECOLI Glucose-1-phosphate thymidylyltransferase 1 OS=Escherichia coli (strain K12) GN=rfbA PE=1 SV=2 2 247 7.0E-16
sp|C1C7B5|GLGC_STRP7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=glgC PE=3 SV=1 1 344 7.0E-16
sp|P26393|RMLA_SALTY Glucose-1-phosphate thymidylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rmlA PE=1 SV=1 2 247 8.0E-16
sp|A5D662|GLMU_PELTS Bifunctional protein GlmU OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=glmU PE=3 SV=1 1 361 9.0E-16
sp|Q03HD2|GLMU_PEDPA Bifunctional protein GlmU OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glmU PE=3 SV=1 4 337 1.0E-15
sp|Q8R752|GLMU_CALS4 Bifunctional protein GlmU OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=glmU PE=3 SV=1 4 350 1.0E-15
sp|B2GFE2|GLMU_LACF3 Bifunctional protein GlmU OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=glmU PE=3 SV=1 4 352 1.0E-15
sp|B2TI07|GLMU_CLOBB Bifunctional protein GlmU OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glmU PE=3 SV=1 3 338 1.0E-15
sp|Q88Z86|GLMU_LACPL Bifunctional protein GlmU OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glmU PE=3 SV=1 3 342 2.0E-15
sp|Q65PH1|GLMU_BACLD Bifunctional protein GlmU OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glmU PE=3 SV=2 3 342 2.0E-15
sp|Q937Z1|GLMU_STAEP Bifunctional protein GlmU OS=Staphylococcus epidermidis GN=glmU PE=3 SV=1 4 342 2.0E-15
sp|A3CM02|GLGC_STRSV Glucose-1-phosphate adenylyltransferase OS=Streptococcus sanguinis (strain SK36) GN=glgC PE=3 SV=1 1 344 2.0E-15
sp|Q5WAD9|GLMU_BACSK Bifunctional protein GlmU OS=Bacillus clausii (strain KSM-K16) GN=glmU PE=3 SV=1 4 347 3.0E-15
sp|B2UXS6|GLMU_CLOBA Bifunctional protein GlmU OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glmU PE=3 SV=1 3 338 3.0E-15
sp|A9NH16|GLMU_ACHLI Bifunctional protein GlmU OS=Acholeplasma laidlawii (strain PG-8A) GN=glmU PE=3 SV=1 3 346 3.0E-15
sp|Q8DT53|GLGC_STRMU Glucose-1-phosphate adenylyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glgC PE=3 SV=2 1 344 4.0E-15
sp|A0PXK8|GLMU_CLONN Bifunctional protein GlmU OS=Clostridium novyi (strain NT) GN=glmU PE=3 SV=2 4 338 5.0E-15
sp|P39629|RMLA_BACSU Glucose-1-phosphate thymidylyltransferase OS=Bacillus subtilis (strain 168) GN=rmlA PE=1 SV=1 1 239 8.0E-15
sp|Q97GX8|GLGC_CLOAB Glucose-1-phosphate adenylyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glgC PE=3 SV=1 3 340 1.0E-14
sp|O06486|RFBF_BACSU Probable glucose-1-phosphate cytidylyltransferase OS=Bacillus subtilis (strain 168) GN=yfnH PE=3 SV=1 1 227 1.0E-14
sp|A6LPJ1|GLMU_CLOB8 Bifunctional protein GlmU OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glmU PE=3 SV=1 4 338 1.0E-14
sp|Q9L385|GLGC_CLOCE Glucose-1-phosphate adenylyltransferase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glgC PE=3 SV=2 1 324 1.0E-14
sp|A3DK82|GLGC_CLOTH Glucose-1-phosphate adenylyltransferase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glgC PE=3 SV=1 3 351 1.0E-14
sp|B2V046|GLGC_CLOBA Glucose-1-phosphate adenylyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glgC PE=3 SV=1 3 363 2.0E-14
sp|A8MK45|GLMU_ALKOO Bifunctional protein GlmU OS=Alkaliphilus oremlandii (strain OhILAs) GN=glmU PE=3 SV=1 1 350 3.0E-14
sp|B2TR25|GLGC_CLOBB Glucose-1-phosphate adenylyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glgC PE=3 SV=1 4 363 3.0E-14
sp|Q8DSX2|GLMU_STRMU Bifunctional protein GlmU OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glmU PE=3 SV=1 3 347 3.0E-14
sp|A4IS22|GLGC_GEOTN Glucose-1-phosphate adenylyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glgC PE=3 SV=1 3 334 4.0E-14
sp|Q38V29|GLMU_LACSS Bifunctional protein GlmU OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=glmU PE=3 SV=1 3 338 4.0E-14
sp|B3W9A3|GLGC_LACCB Glucose-1-phosphate adenylyltransferase OS=Lactobacillus casei (strain BL23) GN=glgC PE=3 SV=1 1 319 4.0E-14
sp|Q036S8|GLGC_LACC3 Glucose-1-phosphate adenylyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=glgC PE=3 SV=1 1 319 4.0E-14
sp|P61888|RMLA2_SHIFL Glucose-1-phosphate thymidylyltransferase 2 OS=Shigella flexneri GN=rffH PE=3 SV=1 1 243 5.0E-14
sp|P61887|RMLA2_ECOLI Glucose-1-phosphate thymidylyltransferase 2 OS=Escherichia coli (strain K12) GN=rffH PE=1 SV=1 1 243 5.0E-14
sp|Q724L5|GLMU_LISMF Bifunctional protein GlmU OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmU PE=3 SV=1 3 350 8.0E-14
sp|C1KYD1|GLMU_LISMC Bifunctional protein GlmU OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=glmU PE=3 SV=1 3 350 8.0E-14
sp|Q9ZAE7|RMLA_ACTS5 Glucose-1-phosphate thymidylyltransferase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbA PE=3 SV=2 1 227 9.0E-14
sp|O66863|GLMU_AQUAE Bifunctional protein GlmU OS=Aquifex aeolicus (strain VF5) GN=glmU PE=3 SV=1 1 355 1.0E-13
sp|P57040|RMLA_NEIMA Glucose-1-phosphate thymidylyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rmlA1 PE=3 SV=1 1 221 1.0E-13
sp|P55255|RMLA_NEIMB Glucose-1-phosphate thymidylyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rmlA1 PE=3 SV=2 1 193 1.0E-13
sp|A8F3W8|GLGC_PSELT Glucose-1-phosphate adenylyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=glgC PE=3 SV=1 3 319 1.0E-13
sp|A2RMB7|GLGC_LACLM Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=glgC PE=3 SV=1 1 333 1.0E-13
sp|A8AYH2|GLGC_STRGC Glucose-1-phosphate adenylyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgC PE=3 SV=1 1 344 1.0E-13
sp|Q8RF63|GLGC_FUSNN Glucose-1-phosphate adenylyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glgC PE=3 SV=1 3 304 2.0E-13
sp|A0AF03|GLMU_LISW6 Bifunctional protein GlmU OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=glmU PE=3 SV=1 3 337 2.0E-13
sp|Q1DCI1|GLMU_MYXXD Bifunctional protein GlmU OS=Myxococcus xanthus (strain DK 1622) GN=glmU PE=3 SV=1 1 356 2.0E-13
sp|Q0SQ61|GLMU_CLOPS Bifunctional protein GlmU OS=Clostridium perfringens (strain SM101 / Type A) GN=glmU PE=3 SV=1 3 338 3.0E-13
sp|Q0SWS5|GLGC_CLOPS Glucose-1-phosphate adenylyltransferase OS=Clostridium perfringens (strain SM101 / Type A) GN=glgC PE=3 SV=1 3 339 3.0E-13
sp|Q890J0|GLGC_LACPL Glucose-1-phosphate adenylyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgC PE=3 SV=1 1 339 3.0E-13
sp|O08326|GLGC_GEOSE Glucose-1-phosphate adenylyltransferase OS=Geobacillus stearothermophilus GN=glgC PE=3 SV=1 3 334 3.0E-13
sp|Q0TMG3|GLMU_CLOP1 Bifunctional protein GlmU OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=glmU PE=3 SV=1 3 338 4.0E-13
sp|C0ZHD4|GLMU_BREBN Bifunctional protein GlmU OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=glmU PE=3 SV=1 1 347 4.0E-13
sp|Q030T6|GLGC_LACLS Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=glgC PE=3 SV=1 1 333 5.0E-13
sp|Q9KGJ6|GLMU_BACHD Bifunctional protein GlmU OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glmU PE=3 SV=1 3 347 6.0E-13
sp|Q8DYE6|GLMU_STRA5 Bifunctional protein GlmU OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmU PE=3 SV=1 4 347 6.0E-13
sp|Q3JZY6|GLMU_STRA1 Bifunctional protein GlmU OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glmU PE=3 SV=1 4 347 6.0E-13
sp|Q8DQ18|GLMU_STRR6 Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmU PE=1 SV=2 4 347 6.0E-13
sp|Q04KU2|GLMU_STRP2 Bifunctional protein GlmU OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glmU PE=3 SV=1 4 347 6.0E-13
sp|A1ALB2|GLMU_PELPD Bifunctional protein GlmU OS=Pelobacter propionicus (strain DSM 2379) GN=glmU PE=3 SV=1 4 338 6.0E-13
sp|P95778|RMLA_STRMU Glucose-1-phosphate thymidylyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rmlA PE=3 SV=1 1 230 7.0E-13
sp|B1YK68|GLGC_EXIS2 Glucose-1-phosphate adenylyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glgC PE=3 SV=1 3 305 8.0E-13
sp|B2G5J5|GLMU_LACRJ Bifunctional protein GlmU OS=Lactobacillus reuteri (strain JCM 1112) GN=glmU PE=3 SV=1 4 347 8.0E-13
sp|A5VI16|GLMU_LACRD Bifunctional protein GlmU OS=Lactobacillus reuteri (strain DSM 20016) GN=glmU PE=3 SV=1 4 347 8.0E-13
sp|Q8E409|GLMU_STRA3 Bifunctional protein GlmU OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmU PE=3 SV=1 4 347 9.0E-13
sp|Q8XHJ3|GLMU_CLOPE Bifunctional protein GlmU OS=Clostridium perfringens (strain 13 / Type A) GN=glmU PE=3 SV=1 3 338 9.0E-13
sp|P30522|GLGC_BACCL Glucose-1-phosphate adenylyltransferase (Fragment) OS=Bacillus caldolyticus GN=glgC PE=3 SV=1 3 224 1.0E-12
sp|Q65FS5|GLGC_BACLD Glucose-1-phosphate adenylyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgC PE=3 SV=1 3 347 1.0E-12
sp|P14192|GLMU_BACSU Bifunctional protein GlmU OS=Bacillus subtilis (strain 168) GN=glmU PE=3 SV=1 3 338 1.0E-12
sp|A3CPC4|GLMU_STRSV Bifunctional protein GlmU OS=Streptococcus sanguinis (strain SK36) GN=glmU PE=3 SV=1 4 347 1.0E-12
sp|Q5L3V0|GLMU_GEOKA Bifunctional protein GlmU OS=Geobacillus kaustophilus (strain HTA426) GN=glmU PE=3 SV=1 4 361 2.0E-12
sp|A7Z0H3|GLMU_BACMF Bifunctional protein GlmU OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glmU PE=3 SV=1 4 338 2.0E-12
sp|P55257|RMLA_YEREN Glucose-1-phosphate thymidylyltransferase OS=Yersinia enterocolitica GN=rmlA PE=3 SV=1 1 243 2.0E-12
sp|Q1WSM9|GLGC_LACS1 Glucose-1-phosphate adenylyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=glgC PE=3 SV=1 1 344 2.0E-12
sp|B8DUN4|GLGC_BIFA0 Glucose-1-phosphate adenylyltransferase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=glgC PE=3 SV=1 4 337 2.0E-12
sp|Q9CHN1|GLGC_LACLA Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glgC PE=3 SV=1 1 333 3.0E-12
sp|A3N4V7|GLMU_BURP6 Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain 668) GN=glmU PE=3 SV=1 1 361 3.0E-12
sp|Q3JWX1|GLMU_BURP1 Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain 1710b) GN=glmU PE=3 SV=2 1 361 3.0E-12
sp|A3NQK0|GLMU_BURP0 Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain 1106a) GN=glmU PE=3 SV=1 1 361 3.0E-12
sp|A1V7Z3|GLMU_BURMS Bifunctional protein GlmU OS=Burkholderia mallei (strain SAVP1) GN=glmU PE=3 SV=1 1 361 3.0E-12
sp|Q62EP0|GLMU_BURMA Bifunctional protein GlmU OS=Burkholderia mallei (strain ATCC 23344) GN=glmU PE=3 SV=1 1 361 3.0E-12
sp|A3MND6|GLMU_BURM7 Bifunctional protein GlmU OS=Burkholderia mallei (strain NCTC 10247) GN=glmU PE=3 SV=1 1 361 3.0E-12
sp|C4Z4L8|GLGC_EUBE2 Glucose-1-phosphate adenylyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glgC PE=3 SV=1 1 348 3.0E-12
sp|Q63Y75|GLMU_BURPS Bifunctional protein GlmU OS=Burkholderia pseudomallei (strain K96243) GN=glmU PE=3 SV=1 1 361 3.0E-12
sp|Q55504|GLMU_SYNY3 Bifunctional protein GlmU OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glmU PE=3 SV=1 5 353 3.0E-12
sp|A6T3N4|GLMU_JANMA Bifunctional protein GlmU OS=Janthinobacterium sp. (strain Marseille) GN=glmU PE=3 SV=1 1 356 3.0E-12
sp|Q8XP97|GLGC_CLOPE Glucose-1-phosphate adenylyltransferase OS=Clostridium perfringens (strain 13 / Type A) GN=glgC PE=3 SV=1 3 324 3.0E-12
sp|B0TBA0|GLMU_HELMI Bifunctional protein GlmU OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glmU PE=3 SV=1 4 359 4.0E-12
sp|Q9KLP4|GLGC2_VIBCH Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glgC2 PE=3 SV=1 3 301 4.0E-12
sp|Q9RW61|GLMU_DEIRA Bifunctional protein GlmU OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glmU PE=3 SV=2 4 338 4.0E-12
sp|A4IJC6|GLMU_GEOTN Bifunctional protein GlmU OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glmU PE=3 SV=1 4 361 4.0E-12
sp|Q1IWX3|GLMU_DEIGD Bifunctional protein GlmU OS=Deinococcus geothermalis (strain DSM 11300) GN=glmU PE=3 SV=1 4 338 5.0E-12
sp|B0C3K5|GLMU_ACAM1 Bifunctional protein GlmU OS=Acaryochloris marina (strain MBIC 11017) GN=glmU PE=3 SV=1 5 347 5.0E-12
sp|B1IBE8|GLMU_STRPI Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glmU PE=3 SV=1 4 347 5.0E-12
sp|C1C6W6|GLMU_STRP7 Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain 70585) GN=glmU PE=3 SV=1 4 347 6.0E-12
sp|Q9L9E6|NOVV_STRNV Glucose-1-phosphate thymidylyltransferase OS=Streptomyces niveus GN=novV PE=3 SV=1 1 221 6.0E-12
sp|C1CDY3|GLMU_STRZJ Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain JJA) GN=glmU PE=3 SV=1 4 347 6.0E-12
sp|B0JJ82|GLMU_MICAN Bifunctional protein GlmU OS=Microcystis aeruginosa (strain NIES-843) GN=glmU PE=3 SV=2 5 347 7.0E-12
sp|B1KTE7|GLMU_CLOBM Bifunctional protein GlmU OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glmU PE=3 SV=1 3 183 7.0E-12
sp|Q6AF21|GLGC_LEIXX Glucose-1-phosphate adenylyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgC PE=3 SV=1 3 337 7.0E-12
sp|Q8Y304|GLMU_RALSO Bifunctional protein GlmU OS=Ralstonia solanacearum (strain GMI1000) GN=glmU PE=3 SV=1 1 356 7.0E-12
sp|A8AY88|GLMU_STRGC Bifunctional protein GlmU OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glmU PE=3 SV=1 4 347 8.0E-12
sp|P37762|RMLA_NEIGO Glucose-1-phosphate thymidylyltransferase OS=Neisseria gonorrhoeae GN=rmlA PE=3 SV=1 1 221 1.0E-11
sp|B7GSX2|GLMU_BIFLS Bifunctional protein GlmU OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=glmU PE=3 SV=1 4 352 1.0E-11
sp|Q8NRU8|GLMU_CORGL Bifunctional protein GlmU OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glmU PE=3 SV=1 4 350 1.0E-11
sp|B1IH02|GLMU_CLOBK Bifunctional protein GlmU OS=Clostridium botulinum (strain Okra / Type B1) GN=glmU PE=3 SV=1 3 183 1.0E-11
sp|B9DRD5|GLMU_STRU0 Bifunctional protein GlmU OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glmU PE=3 SV=1 3 348 2.0E-11
sp|Q118R6|GLMU_TRIEI Bifunctional protein GlmU OS=Trichodesmium erythraeum (strain IMS101) GN=glmU PE=3 SV=1 5 347 2.0E-11
sp|B9L1J9|GLGC_THERP Glucose-1-phosphate adenylyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glgC PE=3 SV=1 4 345 2.0E-11
sp|Q8ET56|GLGC_OCEIH Glucose-1-phosphate adenylyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glgC PE=3 SV=1 3 330 2.0E-11
sp|Q04C57|GLMU_LACDB Bifunctional protein GlmU OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=glmU PE=3 SV=1 4 303 2.0E-11
sp|Q3MC88|GLMU_ANAVT Bifunctional protein GlmU OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=glmU PE=3 SV=1 5 347 2.0E-11
sp|C3KWA1|GLMU_CLOB6 Bifunctional protein GlmU OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glmU PE=3 SV=1 3 183 2.0E-11
sp|Q9CEF8|GLMU_LACLA Bifunctional protein GlmU OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glmU PE=3 SV=1 4 347 2.0E-11
sp|C1CRR4|GLMU_STRZT Bifunctional protein GlmU OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glmU PE=3 SV=1 4 347 2.0E-11
sp|Q03T39|GLMU_LACBA Bifunctional protein GlmU OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=glmU PE=3 SV=1 4 347 2.0E-11
sp|Q49V08|GLMU_STAS1 Bifunctional protein GlmU OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=glmU PE=3 SV=1 3 359 2.0E-11
sp|A4VWR1|GLMU_STRSY Bifunctional protein GlmU OS=Streptococcus suis (strain 05ZYH33) GN=glmU PE=3 SV=2 4 361 2.0E-11
sp|A4W313|GLMU_STRS2 Bifunctional protein GlmU OS=Streptococcus suis (strain 98HAH33) GN=glmU PE=3 SV=2 4 361 2.0E-11
sp|Q97R46|GLMU_STRPN Bifunctional protein GlmU OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmU PE=1 SV=1 4 347 2.0E-11
sp|Q1GBQ8|GLMU_LACDA Bifunctional protein GlmU OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=glmU PE=3 SV=1 4 303 2.0E-11
sp|P39122|GLGC_BACSU Glucose-1-phosphate adenylyltransferase OS=Bacillus subtilis (strain 168) GN=glgC PE=2 SV=1 3 329 3.0E-11
sp|Q8YQB2|GLMU_NOSS1 Bifunctional protein GlmU OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=glmU PE=3 SV=1 5 347 3.0E-11
sp|A6LJD6|GLMU_THEM4 Bifunctional protein GlmU OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glmU PE=3 SV=1 1 347 3.0E-11
sp|Q73WU6|GLGC_MYCPA Glucose-1-phosphate adenylyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=glgC PE=3 SV=1 3 319 3.0E-11
sp|Q87HX3|GLGC2_VIBPA Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=glgC2 PE=3 SV=1 3 329 3.0E-11
sp|A7GJD9|GLMU_CLOBL Bifunctional protein GlmU OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glmU PE=3 SV=1 4 183 3.0E-11
sp|C5CFS2|GLMU_KOSOT Bifunctional protein GlmU OS=Kosmotoga olearia (strain TBF 19.5.1) GN=glmU PE=3 SV=1 1 347 3.0E-11
sp|A5I7S0|GLMU_CLOBH Bifunctional protein GlmU OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glmU PE=3 SV=1 4 183 3.0E-11
sp|A7FPK2|GLMU_CLOB1 Bifunctional protein GlmU OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glmU PE=3 SV=1 4 183 3.0E-11
sp|Q8G5Y5|GLGC_BIFLO Glucose-1-phosphate adenylyltransferase OS=Bifidobacterium longum (strain NCC 2705) GN=glgC PE=3 SV=1 4 319 3.0E-11
sp|B3DSC7|GLGC_BIFLD Glucose-1-phosphate adenylyltransferase OS=Bifidobacterium longum (strain DJO10A) GN=glgC PE=3 SV=1 4 319 3.0E-11
sp|P9WN43|GLGC_MYCTU Glucose-1-phosphate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glgC PE=1 SV=1 3 319 3.0E-11
sp|P9WN42|GLGC_MYCTO Glucose-1-phosphate adenylyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glgC PE=3 SV=1 3 319 3.0E-11
sp|A5U1R1|GLGC_MYCTA Glucose-1-phosphate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glgC PE=3 SV=1 3 319 3.0E-11
sp|C1AMK7|GLGC_MYCBT Glucose-1-phosphate adenylyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=glgC PE=3 SV=1 3 319 3.0E-11
sp|A1KI01|GLGC_MYCBP Glucose-1-phosphate adenylyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=glgC PE=3 SV=1 3 319 3.0E-11
sp|P64242|GLGC_MYCBO Glucose-1-phosphate adenylyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glgC PE=3 SV=1 3 319 3.0E-11
sp|Q1B431|GLMU_MYCSS Bifunctional protein GlmU OS=Mycobacterium sp. (strain MCS) GN=glmU PE=3 SV=1 4 359 4.0E-11
sp|A1UL17|GLMU_MYCSK Bifunctional protein GlmU OS=Mycobacterium sp. (strain KMS) GN=glmU PE=3 SV=1 4 359 4.0E-11
sp|A3Q5G5|GLMU_MYCSJ Bifunctional protein GlmU OS=Mycobacterium sp. (strain JLS) GN=glmU PE=3 SV=1 4 359 4.0E-11
sp|A5ILV3|GLMU_THEP1 Bifunctional protein GlmU OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glmU PE=3 SV=1 1 347 4.0E-11
sp|C5D371|GLMU_GEOSW Bifunctional protein GlmU OS=Geobacillus sp. (strain WCH70) GN=glmU PE=3 SV=1 3 342 4.0E-11
sp|Q8G5P1|GLMU_BIFLO Bifunctional protein GlmU OS=Bifidobacterium longum (strain NCC 2705) GN=glmU PE=3 SV=1 4 352 4.0E-11
sp|P0C7J4|RMLA_XANCP Glucose-1-phosphate thymidylyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rmlA PE=3 SV=1 2 247 4.0E-11
sp|B0RVK9|RMLA_XANCB Glucose-1-phosphate thymidylyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rmlA PE=3 SV=1 2 247 4.0E-11
sp|A1R6L8|GLGC_ARTAT Glucose-1-phosphate adenylyltransferase OS=Arthrobacter aurescens (strain TC1) GN=glgC PE=3 SV=1 3 318 5.0E-11
sp|B1LBD9|GLMU_THESQ Bifunctional protein GlmU OS=Thermotoga sp. (strain RQ2) GN=glmU PE=3 SV=1 1 347 7.0E-11
sp|A3DIP9|GLMU_CLOTH Bifunctional protein GlmU OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glmU PE=3 SV=2 1 338 7.0E-11
sp|A0KB52|GLMU_BURCH Bifunctional protein GlmU OS=Burkholderia cenocepacia (strain HI2424) GN=glmU PE=3 SV=1 1 356 8.0E-11
sp|Q1BSY8|GLMU_BURCA Bifunctional protein GlmU OS=Burkholderia cenocepacia (strain AU 1054) GN=glmU PE=3 SV=1 1 356 8.0E-11
sp|B2T6U5|GLMU_BURPP Bifunctional protein GlmU OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=glmU PE=3 SV=1 1 356 8.0E-11
sp|C1FNF1|GLMU_CLOBJ Bifunctional protein GlmU OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glmU PE=3 SV=1 4 183 9.0E-11
sp|A4QCS3|GLMU_CORGB Bifunctional protein GlmU OS=Corynebacterium glutamicum (strain R) GN=glmU PE=3 SV=1 4 350 1.0E-10
sp|Q13T65|GLMU_BURXL Bifunctional protein GlmU OS=Burkholderia xenovorans (strain LB400) GN=glmU PE=3 SV=2 1 356 1.0E-10
sp|Q9X1W4|GLMU_THEMA Bifunctional protein GlmU OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glmU PE=3 SV=1 1 347 1.0E-10
sp|P55464|RMLA_RHISN Probable glucose-1-phosphate thymidylyltransferase OS=Rhizobium sp. (strain NGR234) GN=rmlA PE=3 SV=1 1 273 1.0E-10
sp|Q72LP1|GLMU_THET2 Bifunctional protein GlmU OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glmU PE=3 SV=2 4 356 1.0E-10
sp|B1JRN4|GLMU_YERPY Bifunctional protein GlmU OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glmU PE=3 SV=1 1 338 2.0E-10
sp|Q663R0|GLMU_YERPS Bifunctional protein GlmU OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmU PE=3 SV=1 1 338 2.0E-10
sp|A4TSJ5|GLMU_YERPP Bifunctional protein GlmU OS=Yersinia pestis (strain Pestoides F) GN=glmU PE=1 SV=1 1 338 2.0E-10
sp|Q1CCH7|GLMU_YERPN Bifunctional protein GlmU OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glmU PE=3 SV=1 1 338 2.0E-10
sp|Q8Z9S7|GLMU_YERPE Bifunctional protein GlmU OS=Yersinia pestis GN=glmU PE=1 SV=1 1 338 2.0E-10
sp|B2K849|GLMU_YERPB Bifunctional protein GlmU OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glmU PE=3 SV=1 1 338 2.0E-10
sp|Q1C097|GLMU_YERPA Bifunctional protein GlmU OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glmU PE=3 SV=1 1 338 2.0E-10
sp|A7FPD8|GLMU_YERP3 Bifunctional protein GlmU OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glmU PE=3 SV=1 1 338 2.0E-10
sp|A5N2Y9|GLGC_CLOK5 Glucose-1-phosphate adenylyltransferase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glgC PE=3 SV=1 1 355 2.0E-10
sp|Q5SLA8|GLMU_THET8 Bifunctional protein GlmU OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glmU PE=3 SV=2 4 356 2.0E-10
sp|B7GS87|GLGC_BIFLS Glucose-1-phosphate adenylyltransferase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=glgC PE=3 SV=1 4 319 2.0E-10
sp|B2IU73|GLMU_NOSP7 Bifunctional protein GlmU OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=glmU PE=3 SV=1 5 347 2.0E-10
sp|Q7V274|GLMU_PROMP Bifunctional protein GlmU OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=glmU PE=3 SV=1 5 355 2.0E-10
sp|A1TDM8|GLGC_MYCVP Glucose-1-phosphate adenylyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=glgC PE=3 SV=1 3 319 2.0E-10
sp|Q6NCT8|GLGC_RHOPA Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glgC PE=3 SV=1 3 329 2.0E-10
sp|Q74LH7|GLMU_LACJO Bifunctional protein GlmU OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=glmU PE=3 SV=1 4 337 2.0E-10
sp|B5E4A8|GLMU_STRP4 Bifunctional protein GlmU OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glmU PE=3 SV=1 4 347 2.0E-10
sp|B3E8Z1|GLGC_GEOLS Glucose-1-phosphate adenylyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glgC PE=3 SV=1 3 325 2.0E-10
sp|B3DSP5|GLMU_BIFLD Bifunctional protein GlmU OS=Bifidobacterium longum (strain DJO10A) GN=glmU PE=3 SV=1 4 352 2.0E-10
sp|Q5YQG3|GLGC_NOCFA Glucose-1-phosphate adenylyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=glgC PE=3 SV=1 3 319 2.0E-10
sp|B3Q9C1|GLGC_RHOPT Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=glgC PE=3 SV=1 3 329 3.0E-10
sp|Q2JII9|GLMU_SYNJB Bifunctional protein GlmU OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=glmU PE=3 SV=1 5 352 3.0E-10
sp|B7KIE0|GLMU_CYAP7 Bifunctional protein GlmU OS=Cyanothece sp. (strain PCC 7424) GN=glmU PE=3 SV=1 5 347 3.0E-10
sp|Q2T1V2|GLMU_BURTA Bifunctional protein GlmU OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glmU PE=3 SV=2 1 356 3.0E-10
sp|Q6GDU6|GTAB_STAAR UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=gtaB PE=3 SV=1 2 233 5.0E-10
sp|Q2YW63|GTAB_STAAB UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gtaB PE=3 SV=1 2 233 6.0E-10
sp|A4J4I2|GLGC_DESRM Glucose-1-phosphate adenylyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glgC PE=3 SV=1 3 313 6.0E-10
sp|Q89G87|GLGC_BRADU Glucose-1-phosphate adenylyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=glgC PE=3 SV=1 3 329 6.0E-10
sp|Q7A3J9|GTAB_STAAN UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain N315) GN=gtaB PE=1 SV=1 2 233 6.0E-10
sp|Q99RD4|GTAB_STAAM UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gtaB PE=3 SV=1 2 233 6.0E-10
sp|Q5HD54|GTAB_STAAC UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain COL) GN=gtaB PE=3 SV=1 2 233 6.0E-10
sp|Q2G1T6|GTAB_STAA8 UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=gtaB PE=1 SV=2 2 233 6.0E-10
sp|Q2FE05|GTAB_STAA3 UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain USA300) GN=gtaB PE=3 SV=2 2 233 6.0E-10
sp|Q8NUU9|GTAB_STAAW UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain MW2) GN=gtaB PE=3 SV=1 2 233 7.0E-10
sp|Q6G6H5|GTAB_STAAS UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=gtaB PE=3 SV=1 2 233 7.0E-10
sp|Q1JD75|GLMU_STRPB Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=glmU PE=3 SV=1 4 347 8.0E-10
sp|C1ACL9|GLGC_GEMAT Glucose-1-phosphate adenylyltransferase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=glgC PE=3 SV=1 5 329 8.0E-10
sp|Q1JN46|GLMU_STRPC Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=glmU PE=3 SV=1 4 347 9.0E-10
sp|Q9CD44|GLMU_MYCLE Bifunctional protein GlmU OS=Mycobacterium leprae (strain TN) GN=glmU PE=3 SV=1 4 359 1.0E-09
sp|B8ZU67|GLMU_MYCLB Bifunctional protein GlmU OS=Mycobacterium leprae (strain Br4923) GN=glmU PE=3 SV=1 4 359 1.0E-09
sp|Q9CCA8|GLGC_MYCLE Glucose-1-phosphate adenylyltransferase OS=Mycobacterium leprae (strain TN) GN=glgC PE=3 SV=1 3 319 1.0E-09
sp|B8ZQY9|GLGC_MYCLB Glucose-1-phosphate adenylyltransferase OS=Mycobacterium leprae (strain Br4923) GN=glgC PE=3 SV=1 3 319 1.0E-09
sp|A2BVS4|GLMU_PROM5 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9515) GN=glmU PE=3 SV=1 5 355 1.0E-09
sp|Q21BQ2|GLGC_RHOPB Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=glgC PE=3 SV=1 3 329 1.0E-09
sp|B1YP62|GLMU_BURA4 Bifunctional protein GlmU OS=Burkholderia ambifaria (strain MC40-6) GN=glmU PE=3 SV=1 1 356 1.0E-09
sp|A1A1B4|GLGC_BIFAA Glucose-1-phosphate adenylyltransferase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=glgC PE=3 SV=1 4 337 1.0E-09
sp|C1A2N3|GLGC_RHOE4 Glucose-1-phosphate adenylyltransferase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=glgC PE=3 SV=1 3 319 2.0E-09
sp|Q48447|GALF_KLEPN UTP--glucose-1-phosphate uridylyltransferase OS=Klebsiella pneumoniae GN=galF PE=3 SV=1 1 243 2.0E-09
sp|B2HS55|GLGC_MYCMM Glucose-1-phosphate adenylyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=glgC PE=3 SV=1 3 319 2.0E-09
sp|C1AZL1|GLGC_RHOOB Glucose-1-phosphate adenylyltransferase OS=Rhodococcus opacus (strain B4) GN=glgC PE=3 SV=1 3 319 2.0E-09
sp|Q0S3Y4|GLGC_RHOJR Glucose-1-phosphate adenylyltransferase OS=Rhodococcus jostii (strain RHA1) GN=glgC PE=3 SV=1 3 319 2.0E-09
sp|A0QPF9|RMLA_MYCS2 Glucose-1-phosphate thymidylyltransferase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlA PE=1 SV=1 1 247 2.0E-09
sp|P0A2K7|GALF_SALTY UTP--glucose-1-phosphate uridylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galF PE=3 SV=1 1 243 2.0E-09
sp|P0A2K8|GALF_SALTI UTP--glucose-1-phosphate uridylyltransferase OS=Salmonella typhi GN=galF PE=3 SV=1 1 243 2.0E-09
sp|P9WH13|RMLA_MYCTU Glucose-1-phosphate thymidylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlA PE=1 SV=1 1 185 2.0E-09
sp|P9WH12|RMLA_MYCTO Glucose-1-phosphate thymidylyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlA PE=3 SV=1 1 185 2.0E-09
sp|A0PVW7|GLGC_MYCUA Glucose-1-phosphate adenylyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=glgC PE=3 SV=1 3 319 3.0E-09
sp|B0UW09|GLMU_HISS2 Bifunctional protein GlmU OS=Histophilus somni (strain 2336) GN=glmU PE=3 SV=2 4 338 3.0E-09
sp|Q5M0U2|GLMU_STRT1 Bifunctional protein GlmU OS=Streptococcus thermophilus (strain CNRZ 1066) GN=glmU PE=3 SV=1 4 347 4.0E-09
sp|Q39ZH2|GLMU_GEOMG Bifunctional protein GlmU OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glmU PE=3 SV=1 1 364 4.0E-09
sp|A1TRG1|GLGC_ACIAC Glucose-1-phosphate adenylyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=glgC PE=3 SV=1 3 324 4.0E-09
sp|Q03LQ1|GLMU_STRTD Bifunctional protein GlmU OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=glmU PE=3 SV=1 4 347 4.0E-09
sp|Q1J847|GLMU_STRPF Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=glmU PE=3 SV=1 4 347 4.0E-09
sp|A1JTC3|GLMU_YERE8 Bifunctional protein GlmU OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glmU PE=3 SV=1 1 338 5.0E-09
sp|Q48UZ1|GLMU_STRPM Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=glmU PE=3 SV=1 4 347 5.0E-09
sp|Q5XDJ2|GLMU_STRP6 Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmU PE=3 SV=2 4 347 6.0E-09
sp|C4LHU9|GLGC_CORK4 Glucose-1-phosphate adenylyltransferase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=glgC PE=3 SV=1 4 319 7.0E-09
sp|Q8CR67|GTAB_STAES UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gtaB PE=3 SV=2 2 233 7.0E-09
sp|Q5HLD1|GTAB_STAEQ UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gtaB PE=3 SV=1 2 233 7.0E-09
sp|Q2RMC5|GLMU_MOOTA Bifunctional protein GlmU OS=Moorella thermoacetica (strain ATCC 39073) GN=glmU PE=3 SV=1 4 350 7.0E-09
sp|Q0I1G0|GLMU_HAES1 Bifunctional protein GlmU OS=Haemophilus somnus (strain 129Pt) GN=glmU PE=3 SV=1 4 359 7.0E-09
sp|Q72G72|GLGC_THET2 Glucose-1-phosphate adenylyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=glgC PE=3 SV=1 3 336 8.0E-09
sp|Q8FQV1|GLMU_COREF Bifunctional protein GlmU OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=glmU PE=3 SV=2 6 348 8.0E-09
sp|Q816G7|GLGC_BACCR Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgC PE=3 SV=1 3 353 8.0E-09
sp|A2RG45|GLMU_STRPG Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=glmU PE=3 SV=1 4 347 9.0E-09
sp|A4T8X4|GLGC_MYCGI Glucose-1-phosphate adenylyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=glgC PE=3 SV=1 3 319 9.0E-09
sp|Q5M5C8|GLMU_STRT2 Bifunctional protein GlmU OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=glmU PE=3 SV=1 4 347 9.0E-09
sp|Q05852|GTAB_BACSU UTP--glucose-1-phosphate uridylyltransferase OS=Bacillus subtilis (strain 168) GN=gtaB PE=1 SV=1 2 255 9.0E-09
sp|B8H8I4|GLGC_ARTCA Glucose-1-phosphate adenylyltransferase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=glgC PE=3 SV=1 3 361 9.0E-09
sp|B1MLL3|GLGC_MYCA9 Glucose-1-phosphate adenylyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=glgC PE=3 SV=1 3 315 9.0E-09
sp|Q49VP4|GTAB2_STAS1 UTP--glucose-1-phosphate uridylyltransferase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gtaB2 PE=3 SV=1 2 233 1.0E-08
sp|Q5SMC1|GLGC_THET8 Glucose-1-phosphate adenylyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=glgC PE=3 SV=1 3 336 1.0E-08
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 1 350 1.0E-08
sp|Q07TH7|GLGC_RHOP5 Glucose-1-phosphate adenylyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=glgC PE=3 SV=1 3 329 1.0E-08
sp|B9J2G7|GLGC_BACCQ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain Q1) GN=glgC PE=3 SV=1 3 353 1.0E-08
sp|Q9A163|GLMU_STRP1 Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M1 GN=glmU PE=3 SV=1 4 347 1.0E-08
sp|Q6ADP6|GLMU_LEIXX Bifunctional protein GlmU OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glmU PE=3 SV=2 4 350 1.0E-08
sp|Q15U36|GLGC1_PSEA6 Glucose-1-phosphate adenylyltransferase 1 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=glgC1 PE=3 SV=1 3 304 1.0E-08
sp|Q3SF69|GLMU_THIDA Bifunctional protein GlmU OS=Thiobacillus denitrificans (strain ATCC 25259) GN=glmU PE=3 SV=1 4 352 1.0E-08
sp|B2GHR6|GLGC_KOCRD Glucose-1-phosphate adenylyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glgC PE=3 SV=1 3 164 1.0E-08
sp|Q7MEE9|GLGC2_VIBVY Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio vulnificus (strain YJ016) GN=glgC2 PE=3 SV=1 4 301 2.0E-08
sp|A0LVY3|GLGC_ACIC1 Glucose-1-phosphate adenylyltransferase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=glgC PE=3 SV=1 3 318 2.0E-08
sp|B1XLT6|GLMU_SYNP2 Bifunctional protein GlmU OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=glmU PE=3 SV=1 5 347 2.0E-08
sp|B8HXB5|GLMU_CYAP4 Bifunctional protein GlmU OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=glmU PE=3 SV=1 5 347 2.0E-08
sp|P37776|GALF_SHIFL UTP--glucose-1-phosphate uridylyltransferase OS=Shigella flexneri GN=galF PE=3 SV=2 1 243 2.0E-08
sp|P0AAB6|GALF_ECOLI UTP--glucose-1-phosphate uridylyltransferase OS=Escherichia coli (strain K12) GN=galF PE=1 SV=1 1 243 2.0E-08
sp|P0AAB7|GALF_ECO57 UTP--glucose-1-phosphate uridylyltransferase OS=Escherichia coli O157:H7 GN=galF PE=3 SV=1 1 243 2.0E-08
sp|A9VM89|GLGC_BACWK Glucose-1-phosphate adenylyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgC PE=3 SV=1 3 353 3.0E-08
sp|Q72YJ4|GLGC_BACC1 Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glgC PE=3 SV=1 3 353 3.0E-08
sp|P0DB63|GLMU_STRPQ Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glmU PE=3 SV=1 4 347 3.0E-08
sp|P0DB62|GLMU_STRP3 Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glmU PE=3 SV=1 4 347 3.0E-08
sp|Q4L8Y7|GTAB_STAHJ UTP--glucose-1-phosphate uridylyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gtaB PE=3 SV=1 2 233 3.0E-08
sp|Q8D7E0|GLGC2_VIBVU Glucose-1-phosphate adenylyltransferase 2 OS=Vibrio vulnificus (strain CMCP6) GN=glgC2 PE=3 SV=1 4 301 3.0E-08
sp|A0RK86|GLGC_BACAH Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=glgC PE=3 SV=1 3 353 3.0E-08
sp|Q6HC16|GLGC_BACHK Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glgC PE=3 SV=1 3 353 4.0E-08
sp|Q632H2|GLGC_BACCZ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glgC PE=3 SV=1 3 353 4.0E-08
sp|Q81K83|GLGC_BACAN Glucose-1-phosphate adenylyltransferase OS=Bacillus anthracis GN=glgC PE=3 SV=1 3 353 4.0E-08
sp|O67379|DIPPS_AQUAE Bifunctional IPC transferase and DIPP synthase OS=Aquifex aeolicus (strain VF5) GN=spsI PE=1 SV=1 3 225 5.0E-08
sp|Q9ZFN4|GLGC_RHORU Glucose-1-phosphate adenylyltransferase OS=Rhodospirillum rubrum GN=glgC PE=3 SV=2 3 229 5.0E-08
sp|Q2RS49|GLGC_RHORT Glucose-1-phosphate adenylyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glgC PE=3 SV=1 3 229 5.0E-08
sp|Q39RY8|GLGC_GEOMG Glucose-1-phosphate adenylyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glgC PE=3 SV=1 3 338 6.0E-08
sp|Q6CYJ8|GLMU_PECAS Bifunctional protein GlmU OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmU PE=3 SV=1 1 359 6.0E-08
sp|B4TN27|GLMU_SALSV Bifunctional protein GlmU OS=Salmonella schwarzengrund (strain CVM19633) GN=glmU PE=3 SV=1 1 347 6.0E-08
sp|B8DU78|GLMU_BIFA0 Bifunctional protein GlmU OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=glmU PE=3 SV=1 4 348 7.0E-08
sp|Q9I291|GALU_PSEAE UTP--glucose-1-phosphate uridylyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=galU PE=3 SV=1 2 242 8.0E-08
sp|Q39C92|GLMU_BURL3 Bifunctional protein GlmU OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=glmU PE=3 SV=1 1 356 8.0E-08
sp|O52049|GLGC_THECA Glucose-1-phosphate adenylyltransferase OS=Thermus caldophilus GN=glgC PE=3 SV=1 3 336 8.0E-08
sp|A7H6H5|GLGC_ANADF Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=glgC PE=3 SV=1 3 329 1.0E-07
sp|Q8P286|GLMU_STRP8 Bifunctional protein GlmU OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glmU PE=3 SV=1 4 342 1.0E-07
sp|Q165E3|GLGC_ROSDO Glucose-1-phosphate adenylyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=glgC PE=3 SV=1 3 329 1.0E-07
sp|Q54800|CAP3C_STREE UTP--glucose-1-phosphate uridylyltransferase OS=Streptococcus pneumoniae GN=cap3C PE=3 SV=1 2 233 1.0E-07
sp|Q58730|Y1334_METJA Putative UTP--glucose-1-phosphate uridylyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1334 PE=3 SV=1 2 191 2.0E-07
sp|Q0RH38|GLGC_FRAAA Glucose-1-phosphate adenylyltransferase OS=Frankia alni (strain ACN14a) GN=glgC PE=3 SV=1 3 322 2.0E-07
sp|Q0BB89|GLMU_BURCM Bifunctional protein GlmU OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=glmU PE=3 SV=1 1 356 2.0E-07
sp|Q31BS3|GLMU_PROM9 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9312) GN=glmU PE=3 SV=1 5 347 2.0E-07
sp|Q6AAD3|GLMU_PROAC Bifunctional protein GlmU OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=glmU PE=3 SV=2 4 361 3.0E-07
sp|A1SBT8|GLMU_SHEAM Bifunctional protein GlmU OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=glmU PE=3 SV=1 4 338 3.0E-07
sp|B5RFW6|GLMU_SALG2 Bifunctional protein GlmU OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|B5BIN3|GLMU_SALPK Bifunctional protein GlmU OS=Salmonella paratyphi A (strain AKU_12601) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|Q5PKV8|GLMU_SALPA Bifunctional protein GlmU OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|A9MXA3|GLMU_SALPB Bifunctional protein GlmU OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|B4SYC8|GLMU_SALNS Bifunctional protein GlmU OS=Salmonella newport (strain SL254) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|B5QUS1|GLMU_SALEP Bifunctional protein GlmU OS=Salmonella enteritidis PT4 (strain P125109) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|B5FN29|GLMU_SALDC Bifunctional protein GlmU OS=Salmonella dublin (strain CT_02021853) GN=glmU PE=3 SV=1 1 347 3.0E-07
sp|O31822|YNGB_BACSU Probable UTP--glucose-1-phosphate uridylyltransferase YngB OS=Bacillus subtilis (strain 168) GN=yngB PE=3 SV=1 2 221 3.0E-07
sp|B5EYZ3|GLMU_SALA4 Bifunctional protein GlmU OS=Salmonella agona (strain SL483) GN=glmU PE=3 SV=1 1 347 4.0E-07
sp|B8J9N1|GLMU_ANAD2 Bifunctional protein GlmU OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glmU PE=3 SV=1 1 356 4.0E-07
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 1 125 4.0E-07
sp|A1KBP7|GLMU_AZOSB Bifunctional protein GlmU OS=Azoarcus sp. (strain BH72) GN=glmU PE=3 SV=1 1 356 4.0E-07
sp|Q65R54|GLMU_MANSM Bifunctional protein GlmU OS=Mannheimia succiniciproducens (strain MBEL55E) GN=glmU PE=3 SV=2 4 347 4.0E-07
sp|Q8Z2Q3|GLMU_SALTI Bifunctional protein GlmU OS=Salmonella typhi GN=glmU PE=3 SV=1 1 347 5.0E-07
sp|B8J7Y5|GLGC_ANAD2 Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glgC PE=3 SV=1 3 325 5.0E-07
sp|A9HWM1|GLMU_BORPD Bifunctional protein GlmU OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=glmU PE=3 SV=1 4 356 5.0E-07
sp|Q57HY1|GLMU_SALCH Bifunctional protein GlmU OS=Salmonella choleraesuis (strain SC-B67) GN=glmU PE=3 SV=1 1 186 6.0E-07
sp|B4ULA3|GLGC_ANASK Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter sp. (strain K) GN=glgC PE=3 SV=1 3 325 6.0E-07
sp|Q8ZKX0|GLMU_SALTY Bifunctional protein GlmU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glmU PE=3 SV=1 1 347 6.0E-07
sp|B4TAW9|GLMU_SALHS Bifunctional protein GlmU OS=Salmonella heidelberg (strain SL476) GN=glmU PE=3 SV=1 1 347 6.0E-07
sp|A7GUA0|GLGC_BACCN Glucose-1-phosphate adenylyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glgC PE=3 SV=1 3 313 7.0E-07
sp|A1SZH6|GLMU_PSYIN Bifunctional protein GlmU OS=Psychromonas ingrahamii (strain 37) GN=glmU PE=3 SV=1 4 338 7.0E-07
sp|Q2JCE9|GLGC_FRASC Glucose-1-phosphate adenylyltransferase OS=Frankia sp. (strain CcI3) GN=glgC PE=3 SV=1 3 322 7.0E-07
sp|C5BQ92|GLGC_TERTT Glucose-1-phosphate adenylyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=glgC PE=3 SV=1 3 226 8.0E-07
sp|Q31DM2|GLMU_THICR Bifunctional protein GlmU OS=Thiomicrospira crunogena (strain XCL-2) GN=glmU PE=3 SV=1 1 361 8.0E-07
sp|A3MZV4|GLMU_ACTP2 Bifunctional protein GlmU OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glmU PE=3 SV=1 4 347 9.0E-07
sp|Q9F664|GALU_HAEDU UTP--glucose-1-phosphate uridylyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=galU PE=3 SV=1 1 243 1.0E-06
sp|A8G3X7|GLMU_PROM2 Bifunctional protein GlmU OS=Prochlorococcus marinus (strain MIT 9215) GN=glmU PE=3 SV=1 5 278 1.0E-06
sp|A8KYU3|GLGC_FRASN Glucose-1-phosphate adenylyltransferase OS=Frankia sp. (strain EAN1pec) GN=glgC PE=3 SV=1 3 322 1.0E-06
sp|A7H432|GLMU_CAMJD Bifunctional protein GlmU OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=glmU PE=3 SV=1 4 187 2.0E-06
sp|Q2IGL4|GLMU_ANADE Bifunctional protein GlmU OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=glmU PE=3 SV=1 1 356 2.0E-06
sp|A9FSV7|GLMU_SORC5 Bifunctional protein GlmU OS=Sorangium cellulosum (strain So ce56) GN=glmU PE=3 SV=1 1 356 2.0E-06
sp|B4U648|GLMU_HYDS0 Bifunctional protein GlmU OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=glmU PE=3 SV=1 1 337 2.0E-06
sp|Q1IQY5|GLMU_KORVE Bifunctional protein GlmU OS=Koribacter versatilis (strain Ellin345) GN=glmU PE=3 SV=1 5 347 3.0E-06
sp|Q59633|GALU2_PSEAI UTP--glucose-1-phosphate uridylyltransferase OS=Pseudomonas aeruginosa GN=galU PE=3 SV=1 2 242 4.0E-06
sp|Q4A122|GTAB1_STAS1 UTP--glucose-1-phosphate uridylyltransferase 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gtaB1 PE=3 SV=1 2 233 4.0E-06
sp|B3H116|GLMU_ACTP7 Bifunctional protein GlmU OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glmU PE=3 SV=1 4 347 5.0E-06
sp|B0BUE6|GLMU_ACTPJ Bifunctional protein GlmU OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=glmU PE=3 SV=1 4 347 7.0E-06
sp|B8F3K4|GLMU_HAEPS Bifunctional protein GlmU OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=glmU PE=3 SV=1 4 361 7.0E-06
sp|B8D6U4|GLMU_BUCAT Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=glmU PE=3 SV=1 4 359 7.0E-06
sp|P57139|GLMU_BUCAI Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=glmU PE=3 SV=1 4 359 7.0E-06
sp|B8D8J0|GLMU_BUCA5 Bifunctional protein GlmU OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=glmU PE=3 SV=1 4 359 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2701
MKGLILVGGFGTRLRPLTLTLPKPLVEFCNKPMIVHQIEALVAAGVTDIVLAVNYRPEVMEKFLAEYEEKYNIKI
EFSVESEPLDTAGPLKLAEKILLKDDSPFFVLNSDVICDYPFAELLQFHKNHGDEGTIVVTKVEEPSKYGVIVHQ
PNHPSRIDRFVEKPVEFVGNRINAGMYIFNTSVLKRIELRPTSIEKETFPSMVRDNQLHSFDLDGFWMDVGQPKD
FLSGTCLYLSSLTKQGSKELTPPTEPYVHGGNVLIDPSAKIGRNCRIGPNVTIGPDVVVGDGVRLQRCVLLRGSK
VKDHAWVKSTIVGWNSTVGRWARLENVSVLGDDVTIGDEIYVNGGSVLPHKSIKANVDVPAIIM*
Coding >Hirsu2|2701
ATGAAGGGACTTATTTTGGTCGGTGGCTTCGGCACTCGCCTTCGCCCCTTGACCCTCACGTTGCCCAAGCCGCTC
GTCGAGTTCTGCAACAAGCCCATGATTGTCCACCAGATTGAGGCCCTGGTCGCCGCCGGCGTCACCGATATCGTC
CTCGCGGTAAACTACCGGCCCGAGGTCATGGAAAAGTTCCTCGCCGAGTACGAAGAGAAATACAATATCAAGATC
GAGTTCTCCGTCGAGTCCGAGCCCCTCGACACCGCCGGGCCCCTCAAGCTGGCCGAGAAGATCCTGCTCAAGGAC
GACTCGCCCTTCTTCGTCCTCAACTCGGACGTCATCTGCGACTACCCCTTCGCCGAGCTGCTCCAATTCCACAAG
AACCACGGCGACGAGGGCACCATTGTCGTGACCAAGGTCGAGGAGCCGTCCAAGTACGGCGTCATCGTCCACCAG
CCCAACCACCCGTCGCGCATCGATCGCTTCGTCGAGAAGCCGGTCGAGTTCGTCGGCAACCGCATCAACGCCGGC
ATGTACATCTTCAACACGTCGGTCCTCAAGCGCATCGAGCTGCGGCCGACGTCCATCGAGAAGGAGACGTTCCCG
TCCATGGTCCGCGACAACCAGCTGCACTCCTTCGACCTCGACGGCTTCTGGATGGACGTCGGCCAGCCCAAGGAC
TTCCTCAGCGGCACCTGTCTCTACCTCTCGTCGCTGACGAAGCAGGGCAGCAAGGAGCTGACGCCGCCGACTGAG
CCCTACGTCCACGGCGGCAACGTCCTCATCGACCCCTCGGCCAAGATTGGCAGGAACTGCCGCATCGGCCCCAAC
GTCACCATCGGCCCCGACGTCGTCGTCGGTGACGGCGTGCGCCTGCAGCGCTGCGTCCTGTTGCGCGGCTCCAAG
GTCAAGGACCACGCCTGGGTCAAGTCGACCATTGTCGGCTGGAACAGCACCGTCGGCCGCTGGGCCCGCCTCGAG
AACGTGTCCGTTCTGGGCGACGACGTCACCATCGGCGACGAGATCTACGTCAACGGCGGCAGCGTCCTGCCGCAC
AAGTCGATCAAGGCCAACGTCGACGTCCCCGCAATCATCATGTGA
Transcript >Hirsu2|2701
ATGAAGGGACTTATTTTGGTCGGTGGCTTCGGCACTCGCCTTCGCCCCTTGACCCTCACGTTGCCCAAGCCGCTC
GTCGAGTTCTGCAACAAGCCCATGATTGTCCACCAGATTGAGGCCCTGGTCGCCGCCGGCGTCACCGATATCGTC
CTCGCGGTAAACTACCGGCCCGAGGTCATGGAAAAGTTCCTCGCCGAGTACGAAGAGAAATACAATATCAAGATC
GAGTTCTCCGTCGAGTCCGAGCCCCTCGACACCGCCGGGCCCCTCAAGCTGGCCGAGAAGATCCTGCTCAAGGAC
GACTCGCCCTTCTTCGTCCTCAACTCGGACGTCATCTGCGACTACCCCTTCGCCGAGCTGCTCCAATTCCACAAG
AACCACGGCGACGAGGGCACCATTGTCGTGACCAAGGTCGAGGAGCCGTCCAAGTACGGCGTCATCGTCCACCAG
CCCAACCACCCGTCGCGCATCGATCGCTTCGTCGAGAAGCCGGTCGAGTTCGTCGGCAACCGCATCAACGCCGGC
ATGTACATCTTCAACACGTCGGTCCTCAAGCGCATCGAGCTGCGGCCGACGTCCATCGAGAAGGAGACGTTCCCG
TCCATGGTCCGCGACAACCAGCTGCACTCCTTCGACCTCGACGGCTTCTGGATGGACGTCGGCCAGCCCAAGGAC
TTCCTCAGCGGCACCTGTCTCTACCTCTCGTCGCTGACGAAGCAGGGCAGCAAGGAGCTGACGCCGCCGACTGAG
CCCTACGTCCACGGCGGCAACGTCCTCATCGACCCCTCGGCCAAGATTGGCAGGAACTGCCGCATCGGCCCCAAC
GTCACCATCGGCCCCGACGTCGTCGTCGGTGACGGCGTGCGCCTGCAGCGCTGCGTCCTGTTGCGCGGCTCCAAG
GTCAAGGACCACGCCTGGGTCAAGTCGACCATTGTCGGCTGGAACAGCACCGTCGGCCGCTGGGCCCGCCTCGAG
AACGTGTCCGTTCTGGGCGACGACGTCACCATCGGCGACGAGATCTACGTCAACGGCGGCAGCGTCCTGCCGCAC
AAGTCGATCAAGGCCAACGTCGACGTCCCCGCAATCATCATGTGA
Gene >Hirsu2|2701
ATGAAGGGTGCGCCCGTCCCCGGCCGACTCGCGCTTCTGTCGCCGCCCTCTCGCGCAATGGAGCTGACTGTGCCG
TCGCAGGACTTATTTTGGTCGGTGGCTTCGGCACTCGCCTTCGCCCCTTGGTGCGTCGCGACCTTGCCCAAGTCC
TTGCCCTATTGCCCTCGCTCCCTCCGCTGACCGGCCATTGCCTGCAGACCCTCACGTTGCCCAAGCCGCTCGTCG
AGTTCTGCAACAAGCCCATGATTGTCCACCAGATTGAGGCCCTGGTCGCCGCCGGCGTCACCGATATCGTCCTCG
CGGTAAACTACCGGCCCGAGGTCATGGAAAAGTTCCTCGCCGAGGTGCGTTTTGCCTCCCCGCGCCACCTCCTCC
TTGGCGCCTGGCGTCGTCTGACCTCGTTGGGCAGTACGAAGAGAAATACAATATCAAGATCGAGTTCTCCGTCGA
GTCCGAGCCCCTCGACACCGCCGGGCCCCTCAAGCTGGCCGAGAAGATCCTGCTCAAGGACGACTCGCCCTTCTT
CGTCCTCAACTCGGACGTCATCTGCGACTACCCCTTCGCCGAGCTGCTCCAATTCCACAAGAACCACGGCGACGA
GGGCACCATTGTCGTGACCAAGGTCGAGGAGCCGTCCAAGTACGGCGTCATCGTCCACCAGCCCAACCACCCGTC
GCGCATCGATCGCTTCGTCGAGAAGCCGGTCGAGTTCGTCGGCAACCGCATCAACGCCGGCATGTACATCTTCAA
CACGTCGGTCCTCAAGCGCATCGAGCTGCGGCCGACGTCCATCGAGAAGGAGACGTTCCCGTCCATGGTCCGCGA
CAACCAGCTGCACTCCTTCGACCTCGACGGCTTCTGGATGGACGTCGGCCAGCCCAAGGACTTCCTCAGCGGCAC
CTGTCTCTACCTCTCGTCGCTGACGAAGCAGGGCAGCAAGGAGCTGACGCCGCCGACTGAGCCCTACGTCCACGG
CGGCAACGTCCTCATCGACCCCTCGGCCAAGATTGGCAGGAACTGCCGCATCGGCCCCAACGTCACCATCGGCCC
CGACGTCGTCGTCGGTGACGGCGTGCGCCTGCAGCGCTGCGTCCTGTTGCGCGGCTCCAAGGTCAAGGACCACGC
CTGGGTCAAGTCGACCATTGTCGGCTGGAACAGCACCGTCGGCCGCTGGGCCCGCCTCGAGAACGTGTCCGTTCT
GGGCGACGACGTCACCATCGGCGACGAGATCTACGTCAACGGCGGCAGCGTCCTGCCGCACAAGTCGATCAAGGC
CAACGTCGACGTCCCCGCAATCATCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail