Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|270
Gene name
LocationContig_105:22932..23774
Strand+
Gene length (bp)842
Transcript length (bp)636
Coding sequence length (bp)636
Protein length (aa) 212

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 4 206 9.0E-07
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 22 207 1.0E-06
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 126 204 1.0E-06
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 13 204 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

Domain # Start End Length
1 40 62 22
2 75 97 22
3 117 139 22
4 144 161 17
5 171 193 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|270
MPARDMDLELDDFGSDRARGPESAAGRAELLPPTDRGSGAYLALACCTISQAPIWGYSVSFGIFQEYYSDGRSGI
VASAGAFASVGATQMGVMYLMMPLAFVTLYRYPHLRPWCGRIGLVLTVASIAASAFVDSVAGLVATQGVLYALGC
GLLFSPMSMYMDEWFVERKGVAYGVMWGGKSAVGVAMPFVFSALLQRFGLRPTLLSCHWDT*
Coding >Hirsu2|270
ATGCCTGCCCGGGACATGGACTTGGAGTTGGACGACTTCGGCTCAGACAGGGCTCGCGGCCCCGAGTCCGCGGCC
GGCCGAGCCGAGCTGCTCCCGCCTACGGATCGAGGCTCCGGCGCATACCTTGCCCTGGCATGCTGCACGATCTCG
CAAGCTCCCATATGGGGATACTCCGTCTCCTTCGGCATCTTCCAGGAGTACTACAGCGATGGTCGGAGCGGCATC
GTGGCCTCGGCCGGCGCCTTCGCCTCCGTCGGCGCAACGCAGATGGGCGTCATGTACCTCATGATGCCCCTGGCC
TTCGTGACGCTCTACCGATACCCTCACCTGCGCCCCTGGTGTGGCCGCATCGGCCTGGTGCTGACCGTCGCGAGC
ATCGCGGCCTCGGCCTTTGTCGACAGCGTCGCTGGCCTCGTCGCGACCCAGGGCGTGCTGTACGCCCTCGGTTGC
GGCTTGCTCTTCAGCCCCATGTCCATGTACATGGACGAGTGGTTCGTGGAGCGCAAGGGCGTCGCCTACGGCGTC
ATGTGGGGAGGCAAGTCTGCCGTCGGGGTCGCGATGCCCTTCGTCTTCAGCGCGCTTTTGCAGCGGTTTGGTCTG
CGGCCGACGCTTCTGTCCTGTCACTGGGATACCTGA
Transcript >Hirsu2|270
ATGCCTGCCCGGGACATGGACTTGGAGTTGGACGACTTCGGCTCAGACAGGGCTCGCGGCCCCGAGTCCGCGGCC
GGCCGAGCCGAGCTGCTCCCGCCTACGGATCGAGGCTCCGGCGCATACCTTGCCCTGGCATGCTGCACGATCTCG
CAAGCTCCCATATGGGGATACTCCGTCTCCTTCGGCATCTTCCAGGAGTACTACAGCGATGGTCGGAGCGGCATC
GTGGCCTCGGCCGGCGCCTTCGCCTCCGTCGGCGCAACGCAGATGGGCGTCATGTACCTCATGATGCCCCTGGCC
TTCGTGACGCTCTACCGATACCCTCACCTGCGCCCCTGGTGTGGCCGCATCGGCCTGGTGCTGACCGTCGCGAGC
ATCGCGGCCTCGGCCTTTGTCGACAGCGTCGCTGGCCTCGTCGCGACCCAGGGCGTGCTGTACGCCCTCGGTTGC
GGCTTGCTCTTCAGCCCCATGTCCATGTACATGGACGAGTGGTTCGTGGAGCGCAAGGGCGTCGCCTACGGCGTC
ATGTGGGGAGGCAAGTCTGCCGTCGGGGTCGCGATGCCCTTCGTCTTCAGCGCGCTTTTGCAGCGGTTTGGTCTG
CGGCCGACGCTTCTGTCCTGTCACTGGGATACCTGA
Gene >Hirsu2|270
ATGCCTGCCCGGGACATGGACTTGGAGTTGGACGACTTCGGCTCAGACAGGGCTCGCGGCCCCGAGTCCGCGGCC
GGCCGAGCCGAGCTGCTCCCGCCTACGGATCGAGGCTCCGGCGCATACCTTGCCCTGGCATGCTGCACGATCTCG
CAAGCTCCCATATGGGGTACAGCCTCCGGACTCGCAGTTGGGGACTGGAGATGCTGACATCAACCGGGCAGGATA
CTCCGTCTCCTTCGGCATCTTCCAGGAGTACTACAGCGATGGTCGGAGCGGCATCGTGGCCTCGGCCGGCGCCTT
CGCCTCCGTCGGCGCAACGCAGATGGGCGTCATGTACCTCATGATGCCCCTGGCCTTCGTGACGCTCTACCGATA
CCCTCACCTGCGCCCCTGGTGTGGCCGCATCGGCCTGGTGCTGACCGTCGCGAGCATCGCGGCCTCGGCCTTTGT
CGACAGCGTCGCTGGCCTCGTCGCGACCCAGGGCGTGCTGTACGCCCTCGGTTGCGGCTTGCTCTTCAGCCCCAT
GTCCATGTACATGGACGAGTGGTTCGTGGAGCGCAAGGGCGTCGCCTACGGCGTCATGTGGGGAGGCAAGTCTGC
CGTCGGGGTCGCGATGCCCTTCGTCTTCAGCGCGCTTTTGCAGCGGTTTGGTCTGCGGCCGACGCTTCTGTCCTG
GTCCGTCGGGTCTGCTGTCCTCGCGCTGCCGACGCTCTTCTTCCTTAGGCCGAGGTTGCCCTTGCCCCGGGCTTA
TCAGGCCCGTCCGCTGCCGTGGTCCTTCATCCGCCATACGTCCTTCTGGATGATGCAGATTGGCGTCGTTATCCA
GTCACTGGGATACCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail