Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2696
Gene name
LocationContig_1656:527..1954
Strand-
Gene length (bp)1427
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06728 PIG-U GPI transamidase subunit PIG-U 2.5E-125 13 387

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 26 407 4.0E-75
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 26 407 2.0E-74
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 26 407 3.0E-74
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 26 407 9.0E-74
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 12 422 1.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H490|PIGU_HUMAN Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens GN=PIGU PE=1 SV=3 26 407 4.0E-75
sp|Q8CHJ1|PIGU_RAT Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Rattus norvegicus GN=Pigu PE=1 SV=3 26 407 2.0E-74
sp|Q8K358|PIGU_MOUSE Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Mus musculus GN=Pigu PE=1 SV=4 26 407 3.0E-74
sp|Q8CHJ0|PIGU_CRIGR Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Cricetulus griseus GN=PIGU PE=1 SV=3 26 407 9.0E-74
sp|P41733|CDC91_YEAST GPI transamidase component GAB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAB1 PE=1 SV=1 12 422 1.0E-60
sp|O13883|PIGU_SCHPO GPI transamidase component GAB1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1952.01 PE=3 SV=2 22 422 2.0E-55
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042765 GPI-anchor transamidase complex Yes
GO:0016255 attachment of GPI anchor to protein Yes
GO:0044446 intracellular organelle part No
GO:0006464 cellular protein modification process No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0044432 endoplasmic reticulum part No
GO:0019538 protein metabolic process No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0043412 macromolecule modification No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 85 107 22
3 128 150 22
4 179 201 22
5 222 244 22
6 277 299 22
7 306 325 19
8 349 371 22
9 378 395 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2696
MTLRGKAGVYAGAALLRLVLTLAFPGLPDLLTGRVEISTPVTSFKRLQEGLFLYNHNVSPYDGGVYHQAPLLLPL
FSLLPDVKHWPIFTSLLYIAVDLLCADALASIADSGEAGQSRLFASPRRARRASGLLVAAAFLFNPFTIATCIGR
STSVFTSCAILHAIARAVRSSPFKAMVALSFASYLSMYPLLLAPPLILLALDRQPEKQRQRMGGGQFAARCGATM
AACLGALLGMSFVLTGRSWEFLARTYGIQLTLSDLTPNVGLWWYFFIEMFDSFRAFFLAVFWLHLSSYVGGLSIR
LRSQPLVVLTLLLGIFAIFKPYPSISDTSLFLAMLPLFWHIFPLMRYSFVASATILYATFLGPAFYYLWIYAGSG
NANFFYAITLVWSLGQSLLVSDLAFAVIRDEWEVERPDMVGKDVKQI*
Coding >Hirsu2|2696
ATGACGCTGCGAGGCAAAGCCGGCGTCTACGCCGGCGCGGCCCTGTTGCGGCTCGTTCTGACCCTGGCCTTCCCG
GGCCTGCCCGACCTACTGACCGGCCGGGTCGAGATCTCAACGCCTGTCACAAGCTTCAAGCGATTGCAGGAAGGC
CTGTTTCTCTACAACCACAATGTCTCGCCCTACGACGGCGGCGTCTATCACCAGGCGCCCCTGCTCCTCCCGCTG
TTCTCGCTCCTCCCCGACGTCAAGCATTGGCCCATCTTCACCTCGCTGCTCTACATTGCGGTGGATTTGCTCTGC
GCCGATGCTCTGGCTAGTATCGCCGACTCGGGCGAGGCCGGCCAGTCGAGGCTGTTCGCATCGCCCCGGCGAGCT
AGACGCGCATCGGGGCTGCTGGTGGCCGCGGCGTTCCTCTTCAACCCGTTTACGATTGCGACGTGCATCGGACGC
TCGACCAGCGTCTTCACGTCCTGCGCCATACTGCACGCCATCGCGAGAGCCGTGCGCAGCTCCCCCTTCAAGGCG
ATGGTGGCCCTCTCCTTCGCCTCGTACCTGTCCATGTACCCGCTGCTCCTGGCCCCGCCGCTCATCCTGCTGGCG
TTGGACCGGCAGCCGGAGAAGCAGCGGCAGCGGATGGGCGGCGGCCAGTTCGCGGCGCGGTGCGGCGCGACGATG
GCGGCCTGCCTGGGCGCGCTGCTCGGCATGTCGTTCGTGCTGACGGGTCGGTCGTGGGAGTTCCTGGCGCGGACG
TACGGCATCCAGCTGACGCTGTCGGACCTGACGCCCAACGTCGGGCTGTGGTGGTACTTCTTTATCGAGATGTTC
GACTCCTTCCGCGCCTTCTTCCTCGCCGTCTTCTGGCTGCACCTGTCGTCGTACGTGGGCGGGCTCAGCATCCGG
CTGCGCAGCCAGCCGCTCGTGGTGCTGACGCTGCTGCTCGGCATCTTCGCCATCTTCAAGCCGTACCCGTCCATC
TCGGACACGAGCCTCTTCCTCGCCATGCTGCCGCTCTTCTGGCACATCTTCCCCCTCATGCGCTACTCCTTCGTC
GCCTCCGCCACCATCCTCTACGCCACCTTCCTCGGCCCGGCCTTCTACTACCTGTGGATCTACGCCGGCAGCGGC
AACGCAAACTTCTTCTACGCCATCACCCTCGTCTGGAGCCTGGGCCAGAGCCTGCTCGTCTCCGACCTGGCCTTT
GCCGTCATCAGGGACGAGTGGGAGGTGGAGCGGCCGGACATGGTCGGCAAGGACGTCAAGCAGATATAG
Transcript >Hirsu2|2696
ATGACGCTGCGAGGCAAAGCCGGCGTCTACGCCGGCGCGGCCCTGTTGCGGCTCGTTCTGACCCTGGCCTTCCCG
GGCCTGCCCGACCTACTGACCGGCCGGGTCGAGATCTCAACGCCTGTCACAAGCTTCAAGCGATTGCAGGAAGGC
CTGTTTCTCTACAACCACAATGTCTCGCCCTACGACGGCGGCGTCTATCACCAGGCGCCCCTGCTCCTCCCGCTG
TTCTCGCTCCTCCCCGACGTCAAGCATTGGCCCATCTTCACCTCGCTGCTCTACATTGCGGTGGATTTGCTCTGC
GCCGATGCTCTGGCTAGTATCGCCGACTCGGGCGAGGCCGGCCAGTCGAGGCTGTTCGCATCGCCCCGGCGAGCT
AGACGCGCATCGGGGCTGCTGGTGGCCGCGGCGTTCCTCTTCAACCCGTTTACGATTGCGACGTGCATCGGACGC
TCGACCAGCGTCTTCACGTCCTGCGCCATACTGCACGCCATCGCGAGAGCCGTGCGCAGCTCCCCCTTCAAGGCG
ATGGTGGCCCTCTCCTTCGCCTCGTACCTGTCCATGTACCCGCTGCTCCTGGCCCCGCCGCTCATCCTGCTGGCG
TTGGACCGGCAGCCGGAGAAGCAGCGGCAGCGGATGGGCGGCGGCCAGTTCGCGGCGCGGTGCGGCGCGACGATG
GCGGCCTGCCTGGGCGCGCTGCTCGGCATGTCGTTCGTGCTGACGGGTCGGTCGTGGGAGTTCCTGGCGCGGACG
TACGGCATCCAGCTGACGCTGTCGGACCTGACGCCCAACGTCGGGCTGTGGTGGTACTTCTTTATCGAGATGTTC
GACTCCTTCCGCGCCTTCTTCCTCGCCGTCTTCTGGCTGCACCTGTCGTCGTACGTGGGCGGGCTCAGCATCCGG
CTGCGCAGCCAGCCGCTCGTGGTGCTGACGCTGCTGCTCGGCATCTTCGCCATCTTCAAGCCGTACCCGTCCATC
TCGGACACGAGCCTCTTCCTCGCCATGCTGCCGCTCTTCTGGCACATCTTCCCCCTCATGCGCTACTCCTTCGTC
GCCTCCGCCACCATCCTCTACGCCACCTTCCTCGGCCCGGCCTTCTACTACCTGTGGATCTACGCCGGCAGCGGC
AACGCAAACTTCTTCTACGCCATCACCCTCGTCTGGAGCCTGGGCCAGAGCCTGCTCGTCTCCGACCTGGCCTTT
GCCGTCATCAGGGACGAGTGGGAGGTGGAGCGGCCGGACATGGTCGGCAAGGACGTCAAGCAGATATAG
Gene >Hirsu2|2696
ATGACGCTGCGAGGCAAAGCCGGCGTCTACGCCGGCGCGGCCCTGTTGCGGCTCGTTCTGACCCTGGCCTTCCCG
GGCCTGCCCGACCTACTGACCGGCCGGGTCGAGATCTCAACGCCTGTCACAAGCTTCAAGCGATGTGAGCTTGCT
CCGTCCGCTCGCTCTATTTCTCTCGTCCTCCACCCGGCAAGATTCGAGTTGGATCACAGTTGCTGACGAGCTCGG
CGCCAAAACGCAGTGCAGGAAGGCCTGTTTCTCTACAACCACAATGTCTCGCCCTACGACGGCGGCGTCTATCAC
CAGGCGCCCCTGCTCCTCCCGCTGTTCTCGCTCCTCCCCGACGTCAAGCATTGGCCCATCTTCACCTCGCTGCTC
TACATTGCGGTGGATTTGCTCTGCGCCGATGCTCTGGCTAGTATCGCCGACTCGGGCGAGGCCGGCCAGTCGAGG
CTGTTCGCATCGCCCCGGCGAGCTAGACGCGCATCGGGGCTGCTGGTGGCCGCGGCGTGAGTTTTTTTTCTTTTC
TTTTCCTTTATAGTCGGACCCTTCCTGACAAGCAAAGCAGGTTCCTCTTCAACCCGTTTACGATTGCGACGTGCA
TCGGACGCTCGACCAGCGTCTTCACGTCCTGCGCCATACTGCACGCCATCGCGAGAGCCGTGCGCAGCTCCCCCT
TCAAGGCGATGGTGGCCCTCTCCTTCGCCTCGTACCTGTCCATGTACCCGCTGCTCCTGGCCCCGCCGCTCATCC
TGCTGGCGTTGGACCGGCAGCCGGAGAAGCAGCGGCAGCGGATGGGCGGCGGCCAGTTCGCGGCGCGGTGCGGCG
CGACGATGGCGGCCTGCCTGGGCGCGCTGCTCGGCATGTCGTTCGTGCTGACGGGTCGGTCGTGGGAGTTCCTGG
CGCGGACGTACGGCATCCAGCTGACGCTGTCGGACCTGACGCCCAACGTCGGGCTGTGGTGGTACTTCTTTATCG
AGATGTTCGACTCCTTCCGCGCCTTCTTCCTCGCCGTCTTCTGGCTGCACCTGTCGTCGTACGTGGGCGGGCTCA
GCATCCGGCTGCGCAGCCAGCCGCTCGTGGTGCTGACGCTGCTGCTCGGCATCTTCGCCATCTTCAAGCCGTACC
CGTCCATCTCGGACACGAGCCTCTTCCTCGCCATGCTGCCGCTCTTCTGGCACATCTTCCCCCTCATGCGCTACT
CCTTCGTCGCCTCCGCCACCATCCTCTACGCCACCTTCCTCGGCCCGGCCTTCTACTACCTGTGGATCTACGCCG
GCAGCGGCAACGCAAACTTCTTCTACGCCATCACCCTCGTCTGGAGCCTGGGCCAGAGCCTGCTCGTCTCCGACC
TGGCCTTTGCCGTCATCAGGGACGAGTGGGAGGTGGAGCGGCCGGACATGGTCGGCAAGGACGTCAAGCAGATAT
AG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail