Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2693
Gene name
LocationContig_1655:672..2182
Strand-
Gene length (bp)1510
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01733 Nucleoside_tran Nucleoside transporter 9.6E-36 162 471

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P31381|FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN26 PE=1 SV=1 29 474 4.0E-37
sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=1 SV=3 57 471 4.0E-19
sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus GN=Slc29a3 PE=1 SV=2 57 465 8.0E-18
sp|Q14542|S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens GN=SLC29A2 PE=1 SV=3 60 469 1.0E-16
sp|Q61672|S29A2_MOUSE Equilibrative nucleoside transporter 2 OS=Mus musculus GN=Slc29a2 PE=1 SV=2 60 469 7.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P31381|FUN26_YEAST Nucleoside transporter FUN26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN26 PE=1 SV=1 29 474 4.0E-37
sp|O54698|S29A1_RAT Equilibrative nucleoside transporter 1 OS=Rattus norvegicus GN=Slc29a1 PE=1 SV=3 57 471 4.0E-19
sp|Q80WK7|S29A3_RAT Equilibrative nucleoside transporter 3 OS=Rattus norvegicus GN=Slc29a3 PE=1 SV=2 57 465 8.0E-18
sp|Q14542|S29A2_HUMAN Equilibrative nucleoside transporter 2 OS=Homo sapiens GN=SLC29A2 PE=1 SV=3 60 469 1.0E-16
sp|Q61672|S29A2_MOUSE Equilibrative nucleoside transporter 2 OS=Mus musculus GN=Slc29a2 PE=1 SV=2 60 469 7.0E-16
sp|Q99808|S29A1_HUMAN Equilibrative nucleoside transporter 1 OS=Homo sapiens GN=SLC29A1 PE=1 SV=3 59 469 1.0E-15
sp|Q9JIM1|S29A1_MOUSE Equilibrative nucleoside transporter 1 OS=Mus musculus GN=Slc29a1 PE=1 SV=3 59 471 4.0E-15
sp|A1A4N1|S29A3_BOVIN Equilibrative nucleoside transporter 3 OS=Bos taurus GN=SLC29A3 PE=2 SV=1 57 474 5.0E-15
sp|Q99P65|S29A3_MOUSE Equilibrative nucleoside transporter 3 OS=Mus musculus GN=Slc29a3 PE=1 SV=1 57 465 2.0E-14
sp|O54699|S29A2_RAT Equilibrative nucleoside transporter 2 OS=Rattus norvegicus GN=Slc29a2 PE=2 SV=1 60 469 7.0E-14
sp|Q9BZD2|S29A3_HUMAN Equilibrative nucleoside transporter 3 OS=Homo sapiens GN=SLC29A3 PE=1 SV=3 57 474 1.0E-13
sp|Q84XI3|ENT8_ARATH Equilibrative nucleotide transporter 8 OS=Arabidopsis thaliana GN=ETN8 PE=2 SV=1 44 469 5.0E-12
sp|Q8VXY7|ENT1_ARATH Equilibrative nucleotide transporter 1 OS=Arabidopsis thaliana GN=ENT1 PE=1 SV=1 57 468 1.0E-11
sp|Q8R139|S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus GN=Slc29a4 PE=1 SV=1 358 469 2.0E-06
sp|Q7RTT9|S29A4_HUMAN Equilibrative nucleoside transporter 4 OS=Homo sapiens GN=SLC29A4 PE=1 SV=1 358 470 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005337 nucleoside transmembrane transporter activity Yes
GO:1901642 nucleoside transmembrane transport Yes
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0071702 organic substance transport No
GO:0051234 establishment of localization No
GO:0015931 nucleobase-containing compound transport No
GO:0051179 localization No
GO:0055085 transmembrane transport No
GO:0044425 membrane part No
GO:0015858 nucleoside transport No
GO:0031224 intrinsic component of membrane No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:1901264 carbohydrate derivative transport No
GO:0071705 nitrogen compound transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 58 80 22
2 95 114 19
3 127 149 22
4 159 181 22
5 194 216 22
6 245 267 22
7 307 329 22
8 344 361 17
9 412 434 22
10 449 471 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2693
MDRAKRALGQMPPDAAEYEPLTSADLEGEEEEEAAAAFGASAAADDLDDAPFSWVEYAIFVFLGVAMLWAWNMFL
AAAPYFASRFSRDLWIEANFQSAILTVSTFVNLVTLVVLTNVQRTASYTFRINLALAANTAVFALLTCSTALFLD
ASPGLYLAFLLAMVAGTSWATGLIQNGSFAFAASFGRPEYTQALMAGQGIAGVLPAVAQVVTVLLFPPQQQQQQQ
QQPHSDVAARQGRGRGQTSAFVYFLTAVVISVAALAAFIPLVRRRRLALERCMPEHMAASATSIQEVEQAARKEV
SLWRLFAKLRWLAVGVALTFAVTMFFPVFTTKIVSVRGDGGGPLFRPAAFIPLGFLFWNLGDLGGRMATALPPSL
SHRPLLLFLLAVARVGQLPLYLLCNVGGRGAAVPSDFFYLFVVQLLFGLSNGWLGSSFMMAAGDWVEPGEREATG
GFMGLFLVIGLTVGSLLSFTLAKI*
Coding >Hirsu2|2693
ATGGATCGAGCCAAGAGGGCCTTGGGCCAGATGCCGCCCGATGCCGCAGAGTATGAACCTCTGACGAGCGCAGAT
CTGGAGGGGGAGGAGGAGGAGGAAGCTGCCGCGGCCTTCGGGGCCTCTGCAGCCGCTGACGATCTCGACGATGCT
CCCTTCTCGTGGGTCGAGTACGCCATCTTCGTCTTCCTCGGCGTGGCCATGCTCTGGGCCTGGAACATGTTCCTC
GCAGCCGCGCCCTACTTCGCCTCGCGCTTCTCCCGCGACCTCTGGATAGAGGCCAACTTCCAGTCGGCCATCTTG
ACCGTGTCGACCTTTGTCAACCTCGTCACCCTCGTCGTCCTGACCAACGTCCAGCGCACCGCCTCGTACACGTTC
CGCATCAACCTCGCCCTCGCCGCCAACACGGCCGTCTTCGCGCTGCTGACCTGCTCCACCGCCCTGTTCCTCGAC
GCCTCTCCCGGCCTCTACCTCGCCTTCCTGCTGGCCATGGTCGCCGGCACCTCGTGGGCCACGGGCCTGATCCAG
AACGGCTCCTTCGCCTTCGCCGCCAGCTTCGGCCGGCCCGAGTACACCCAGGCCCTCATGGCCGGCCAGGGCATC
GCCGGCGTCCTCCCCGCCGTCGCTCAGGTCGTCACCGTCCTCCTCTTCCCGCCGCAGCAACAGCAGCAGCAGCAG
CAGCAGCCGCATTCGGACGTCGCGGCACGCCAGGGTCGGGGCCGGGGCCAGACGTCGGCCTTTGTCTACTTCCTC
ACCGCCGTGGTCATCTCGGTCGCCGCCCTGGCCGCCTTCATCCCCCTCGTGCGGAGGCGCCGCCTGGCGCTGGAG
CGCTGCATGCCGGAGCACATGGCCGCGTCGGCGACGAGTATCCAGGAGGTGGAGCAGGCGGCGCGCAAGGAGGTG
TCGCTGTGGCGCCTGTTCGCCAAGCTGCGCTGGCTCGCCGTCGGCGTGGCGCTTACCTTCGCCGTCACCATGTTC
TTCCCCGTCTTCACCACCAAGATCGTGTCGGTGCGCGGCGATGGCGGCGGCCCCCTCTTCCGCCCGGCCGCCTTC
ATCCCGCTCGGCTTCCTCTTCTGGAACCTGGGCGACCTCGGCGGCCGGATGGCGACGGCCCTGCCCCCGTCGCTC
AGCCACCGGCCGCTGCTGCTCTTCCTGCTGGCCGTCGCCCGCGTCGGCCAGCTGCCGCTCTACCTGCTGTGCAAC
GTCGGCGGCCGCGGCGCCGCCGTCCCCAGCGACTTCTTCTACCTCTTCGTCGTCCAGCTGCTCTTCGGCCTGTCC
AACGGCTGGCTCGGCTCCAGCTTCATGATGGCCGCCGGCGACTGGGTCGAGCCCGGCGAGCGCGAGGCTACCGGC
GGCTTCATGGGCCTCTTCCTCGTCATCGGCCTCACCGTCGGCAGCCTGCTGAGCTTCACCCTGGCCAAGATATAG
Transcript >Hirsu2|2693
ATGGATCGAGCCAAGAGGGCCTTGGGCCAGATGCCGCCCGATGCCGCAGAGTATGAACCTCTGACGAGCGCAGAT
CTGGAGGGGGAGGAGGAGGAGGAAGCTGCCGCGGCCTTCGGGGCCTCTGCAGCCGCTGACGATCTCGACGATGCT
CCCTTCTCGTGGGTCGAGTACGCCATCTTCGTCTTCCTCGGCGTGGCCATGCTCTGGGCCTGGAACATGTTCCTC
GCAGCCGCGCCCTACTTCGCCTCGCGCTTCTCCCGCGACCTCTGGATAGAGGCCAACTTCCAGTCGGCCATCTTG
ACCGTGTCGACCTTTGTCAACCTCGTCACCCTCGTCGTCCTGACCAACGTCCAGCGCACCGCCTCGTACACGTTC
CGCATCAACCTCGCCCTCGCCGCCAACACGGCCGTCTTCGCGCTGCTGACCTGCTCCACCGCCCTGTTCCTCGAC
GCCTCTCCCGGCCTCTACCTCGCCTTCCTGCTGGCCATGGTCGCCGGCACCTCGTGGGCCACGGGCCTGATCCAG
AACGGCTCCTTCGCCTTCGCCGCCAGCTTCGGCCGGCCCGAGTACACCCAGGCCCTCATGGCCGGCCAGGGCATC
GCCGGCGTCCTCCCCGCCGTCGCTCAGGTCGTCACCGTCCTCCTCTTCCCGCCGCAGCAACAGCAGCAGCAGCAG
CAGCAGCCGCATTCGGACGTCGCGGCACGCCAGGGTCGGGGCCGGGGCCAGACGTCGGCCTTTGTCTACTTCCTC
ACCGCCGTGGTCATCTCGGTCGCCGCCCTGGCCGCCTTCATCCCCCTCGTGCGGAGGCGCCGCCTGGCGCTGGAG
CGCTGCATGCCGGAGCACATGGCCGCGTCGGCGACGAGTATCCAGGAGGTGGAGCAGGCGGCGCGCAAGGAGGTG
TCGCTGTGGCGCCTGTTCGCCAAGCTGCGCTGGCTCGCCGTCGGCGTGGCGCTTACCTTCGCCGTCACCATGTTC
TTCCCCGTCTTCACCACCAAGATCGTGTCGGTGCGCGGCGATGGCGGCGGCCCCCTCTTCCGCCCGGCCGCCTTC
ATCCCGCTCGGCTTCCTCTTCTGGAACCTGGGCGACCTCGGCGGCCGGATGGCGACGGCCCTGCCCCCGTCGCTC
AGCCACCGGCCGCTGCTGCTCTTCCTGCTGGCCGTCGCCCGCGTCGGCCAGCTGCCGCTCTACCTGCTGTGCAAC
GTCGGCGGCCGCGGCGCCGCCGTCCCCAGCGACTTCTTCTACCTCTTCGTCGTCCAGCTGCTCTTCGGCCTGTCC
AACGGCTGGCTCGGCTCCAGCTTCATGATGGCCGCCGGCGACTGGGTCGAGCCCGGCGAGCGCGAGGCTACCGGC
GGCTTCATGGGCCTCTTCCTCGTCATCGGCCTCACCGTCGGCAGCCTGCTGAGCTTCACCCTGGCCAAGATATAG
Gene >Hirsu2|2693
ATGGATCGAGCCAAGAGGGCCTTGGGCCAGATGCCGCCCGATGCCGCAGAGTATGAACCTCTGACGAGCGCAGAT
CTGGAGGGGGAGGAGGAGGAGGAAGCTGCCGCGGCCTTCGGGGCCTCTGCAGCCGCTGACGATCTCGACGATGCT
CCCTTCTCGTGGGTCGAGTACGCCATCTTCGTCTTCCTCGGCGTGGCCATGCTCTGGGCCTGGTACGTTGTCCAG
CTCTGCCTCCTTGCACCATGCATGATCATCATCCCTTCCTCTCCGCGCTGACCCGTTGGCCCTCTCGCGCAGGAA
CATGTTCCTCGCAGCCGCGCCCTACTTCGCCTCGCGCTTCTCCCGCGACCTCTGGATAGAGGCCAACTTCCAGTC
GGCCATCTTGACCGTGTCGACCTTTGTCAACCTCGTCACCCTCGTCGTCCTGACCAACGTCCAGCGCACCGCCTC
GTACACGTTCCGCATCAACCTCGCCCTCGCCGCCAACACGGCCGTCTTCGCGCTGCTGACCTGCTCCACCGCCCT
GTTCCTCGACGCCTCTCCCGGCCTCTACCTCGCCTTCCTGCTGGCCATGGTCGCCGGCACCTCGTGGGCCACGGG
CCTGATCCAGAACGGCTCCTTCGCCTTCGCCGCCAGCTTCGGCCGGCCCGAGTACACCCAGGCCCTCATGGCCGG
CCAGGGCATCGCCGGCGTCCTCCCCGCCGTCGCTCAGGTCGTCACCGTCCTCCTCTTCCCGCCGCAGCAACAGCA
GCAGCAGCAGCAGCAGCCGCATTCGGACGTCGCGGCACGCCAGGGTCGGGGCCGGGGCCAGACGTCGGCCTTTGT
CTACTTCCTCACCGCCGTGGTCATCTCGGTCGCCGCCCTGGCCGCCTTCATCCCCCTCGTGCGGAGGCGCCGCCT
GGCGCTGGAGCGCTGCATGCCGGAGCACATGGCCGCGTCGGCGACGAGTATCCAGGAGGTGGAGCAGGCGGCGCG
CAAGGAGGTGTCGCTGTGGCGCCTGTTCGCCAAGCTGCGCTGGCTCGCCGTCGGCGTGGCGCTTACCTTCGCCGT
CACCATGTTCTTCCCCGTCTTCACCACCAAGATCGTGTCGGTGCGCGGCGATGGCGGCGGCCCCCTCTTCCGCCC
GGCCGCCTTCATCCCGCTCGGCTTCCTCTTCTGGAACCTGGGCGACCTCGGCGGCCGGATGGCGACGGCCCTGCC
CCCGTCGCTCAGCCACCGGCCGCTGCTGCTCTTCCTGCTGGCCGTCGCCCGCGTCGGCCAGCTGCCGCTCTACCT
GCTGTGCAACGTCGGCGGCCGCGGCGCCGCCGTCCCCAGCGACTTCTTCTACCTCTTCGTCGTCCAGCTGCTCTT
CGGCCTGTCCAACGGCTGGCTCGGCTCCAGCTTCATGATGGCCGCCGGCGACTGGGTCGAGCCCGGCGAGCGCGA
GGCTACCGGCGGCTTCATGGGCCTCTTCCTCGTCATCGGCCTCACCGTCGGCAGCCTGCTGAGCTTCACCCTGGC
CAAGATATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail