Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2692
Gene name
LocationContig_1654:646..2155
Strand-
Gene length (bp)1509
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16782 SIL1 Nucleotide exchange factor SIL1 2.6E-10 144 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BTV5|SIL1_DEBHA Nucleotide exchange factor SIL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SIL1 PE=3 SV=2 40 313 9.0E-28
sp|Q5A360|SIL1_CANAL Nucleotide exchange factor SIL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIL1 PE=3 SV=1 14 231 1.0E-19
sp|Q99158|SIL1_YARLI Nucleotide exchange factor SIL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SIL1 PE=1 SV=2 52 287 8.0E-16
sp|Q758U2|SIL1_ASHGO Nucleotide exchange factor SIL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIL1 PE=3 SV=1 41 294 4.0E-13
sp|Q08199|SIL1_YEAST Nucleotide exchange factor SIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIL1 PE=1 SV=1 27 243 9.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BTV5|SIL1_DEBHA Nucleotide exchange factor SIL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SIL1 PE=3 SV=2 40 313 9.0E-28
sp|Q5A360|SIL1_CANAL Nucleotide exchange factor SIL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIL1 PE=3 SV=1 14 231 1.0E-19
sp|Q99158|SIL1_YARLI Nucleotide exchange factor SIL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SIL1 PE=1 SV=2 52 287 8.0E-16
sp|Q758U2|SIL1_ASHGO Nucleotide exchange factor SIL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIL1 PE=3 SV=1 41 294 4.0E-13
sp|Q08199|SIL1_YEAST Nucleotide exchange factor SIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIL1 PE=1 SV=1 27 243 9.0E-11
sp|Q9VBV5|SIL1_DROME Nucleotide exchange factor SIL1 OS=Drosophila melanogaster GN=CG10420 PE=2 SV=1 57 107 6.0E-07
sp|Q6NUA7|SIL1_XENLA Nucleotide exchange factor SIL1 OS=Xenopus laevis GN=sil1 PE=2 SV=1 10 91 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000774 adenyl-nucleotide exchange factor activity Yes
GO:0005783 endoplasmic reticulum Yes
GO:0017076 purine nucleotide binding No
GO:0043227 membrane-bounded organelle No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0044424 intracellular part No
GO:0060590 ATPase regulator activity No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0043231 intracellular membrane-bounded organelle No
GO:0030554 adenyl nucleotide binding No
GO:0030234 enzyme regulator activity No
GO:0043229 intracellular organelle No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0043226 organelle No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0098772 molecular function regulator No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 33 0.45

Transmembrane Domains

Domain # Start End Length
1 453 475 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2692
MGQGRSNISSSPILRAIVLALFLSFSVTSASAAPPQSPPGEVICSPSDPQDCYPRTFHPTDKFQVVREGQDIPPG
LHVRLNITTGLKEAKINVPGESDSSLNGLPIDGSLVVSPQPDDDGQQTPKGAPAYDPVGKIKKPQQESESFTAAT
KMLREGNLRHNHAVDESLDGLDELSHDMYYGLKIAEDTEVVRALFCLMVSQHVPVSTGSFIPRDLRAASILVGTL
SNNPPARNKVADAWPELRDGHCPKSDLTLGQALFDSLVPTGSKDAADVKKSAASIKAIVPVVNDLLKNDKMRAEF
LAQGGMERLLQVLVLEGHEWAGAQRKVGQLALDNFLDADMGAKLGQWPTAPSLDDRQCRSAGRSPPDGCWDHHVA
RIAEANKHQQGHWSTDLHDKLSAARKASGSGQAPGSPYDSGMAHSSDAESSEEAKDQPDGAGETQHKLSGPGPSP
YYFFYLLLVVTVGVCVLHTLGFSVLGAFRRLLSRR*
Coding >Hirsu2|2692
ATGGGCCAGGGCCGGTCAAACATCAGCTCCTCACCCATCTTGCGGGCCATCGTCTTGGCCCTCTTTCTCTCCTTC
TCCGTCACATCAGCCTCGGCCGCACCTCCTCAGAGCCCCCCCGGAGAAGTCATCTGTTCTCCTTCGGACCCCCAA
GACTGCTATCCCCGGACCTTCCATCCAACGGACAAGTTCCAGGTCGTGCGCGAGGGCCAAGACATCCCCCCCGGA
TTGCACGTGCGGCTCAACATCACGACGGGCCTGAAGGAGGCCAAGATCAACGTCCCCGGCGAGTCGGACTCGTCC
CTCAACGGCCTGCCCATCGACGGGTCGCTTGTTGTTTCCCCCCAGCCGGATGACGACGGCCAACAGACGCCCAAG
GGCGCGCCGGCATACGACCCCGTCGGCAAGATCAAGAAGCCCCAGCAGGAATCCGAGTCCTTCACGGCAGCCACG
AAGATGCTTCGCGAAGGCAACCTTCGCCACAACCATGCCGTCGACGAGTCTCTCGACGGCCTCGACGAGCTCTCT
CACGACATGTACTACGGCTTGAAGATCGCCGAGGACACCGAGGTCGTCCGCGCCCTCTTCTGCCTCATGGTCAGT
CAACACGTGCCCGTGAGCACCGGTAGCTTCATCCCCCGTGACCTGCGCGCCGCCTCCATCCTCGTCGGCACCCTC
TCCAACAACCCCCCGGCCCGGAACAAGGTGGCCGACGCCTGGCCCGAGCTGAGGGACGGCCACTGCCCCAAGAGC
GACCTGACGCTCGGCCAGGCCTTGTTCGACAGCCTCGTCCCGACCGGGAGCAAAGATGCGGCCGACGTCAAGAAG
TCGGCCGCGTCCATCAAGGCCATAGTCCCGGTCGTCAACGACCTCCTCAAGAACGACAAGATGCGGGCCGAATTC
CTCGCCCAGGGCGGCATGGAGCGGCTCCTCCAGGTCTTGGTCCTCGAGGGGCACGAGTGGGCCGGCGCGCAGCGC
AAGGTCGGACAGCTCGCCCTCGACAACTTCCTCGACGCCGACATGGGCGCCAAACTGGGACAGTGGCCCACGGCG
CCGAGTCTGGACGACAGGCAATGCCGGTCGGCCGGGCGCAGCCCCCCGGACGGCTGCTGGGACCACCACGTCGCC
AGGATCGCCGAGGCCAACAAGCACCAGCAGGGCCACTGGAGCACCGACCTGCACGACAAGCTGTCGGCGGCGCGC
AAGGCTTCCGGCTCCGGCCAGGCCCCCGGCAGCCCCTACGACTCGGGCATGGCTCACAGCAGCGACGCCGAGTCC
AGCGAGGAAGCCAAGGACCAACCCGACGGCGCTGGCGAGACGCAGCACAAGCTTTCCGGCCCTGGGCCGTCGCCG
TATTACTTCTTTTACCTTTTGCTGGTCGTGACCGTCGGCGTTTGCGTGCTGCATACCTTGGGGTTTTCGGTGTTG
GGCGCATTCCGCCGCCTGCTGTCGCGTCGTTGA
Transcript >Hirsu2|2692
ATGGGCCAGGGCCGGTCAAACATCAGCTCCTCACCCATCTTGCGGGCCATCGTCTTGGCCCTCTTTCTCTCCTTC
TCCGTCACATCAGCCTCGGCCGCACCTCCTCAGAGCCCCCCCGGAGAAGTCATCTGTTCTCCTTCGGACCCCCAA
GACTGCTATCCCCGGACCTTCCATCCAACGGACAAGTTCCAGGTCGTGCGCGAGGGCCAAGACATCCCCCCCGGA
TTGCACGTGCGGCTCAACATCACGACGGGCCTGAAGGAGGCCAAGATCAACGTCCCCGGCGAGTCGGACTCGTCC
CTCAACGGCCTGCCCATCGACGGGTCGCTTGTTGTTTCCCCCCAGCCGGATGACGACGGCCAACAGACGCCCAAG
GGCGCGCCGGCATACGACCCCGTCGGCAAGATCAAGAAGCCCCAGCAGGAATCCGAGTCCTTCACGGCAGCCACG
AAGATGCTTCGCGAAGGCAACCTTCGCCACAACCATGCCGTCGACGAGTCTCTCGACGGCCTCGACGAGCTCTCT
CACGACATGTACTACGGCTTGAAGATCGCCGAGGACACCGAGGTCGTCCGCGCCCTCTTCTGCCTCATGGTCAGT
CAACACGTGCCCGTGAGCACCGGTAGCTTCATCCCCCGTGACCTGCGCGCCGCCTCCATCCTCGTCGGCACCCTC
TCCAACAACCCCCCGGCCCGGAACAAGGTGGCCGACGCCTGGCCCGAGCTGAGGGACGGCCACTGCCCCAAGAGC
GACCTGACGCTCGGCCAGGCCTTGTTCGACAGCCTCGTCCCGACCGGGAGCAAAGATGCGGCCGACGTCAAGAAG
TCGGCCGCGTCCATCAAGGCCATAGTCCCGGTCGTCAACGACCTCCTCAAGAACGACAAGATGCGGGCCGAATTC
CTCGCCCAGGGCGGCATGGAGCGGCTCCTCCAGGTCTTGGTCCTCGAGGGGCACGAGTGGGCCGGCGCGCAGCGC
AAGGTCGGACAGCTCGCCCTCGACAACTTCCTCGACGCCGACATGGGCGCCAAACTGGGACAGTGGCCCACGGCG
CCGAGTCTGGACGACAGGCAATGCCGGTCGGCCGGGCGCAGCCCCCCGGACGGCTGCTGGGACCACCACGTCGCC
AGGATCGCCGAGGCCAACAAGCACCAGCAGGGCCACTGGAGCACCGACCTGCACGACAAGCTGTCGGCGGCGCGC
AAGGCTTCCGGCTCCGGCCAGGCCCCCGGCAGCCCCTACGACTCGGGCATGGCTCACAGCAGCGACGCCGAGTCC
AGCGAGGAAGCCAAGGACCAACCCGACGGCGCTGGCGAGACGCAGCACAAGCTTTCCGGCCCTGGGCCGTCGCCG
TATTACTTCTTTTACCTTTTGCTGGTCGTGACCGTCGGCGTTTGCGTGCTGCATACCTTGGGGTTTTCGGTGTTG
GGCGCATTCCGCCGCCTGCTGTCGCGTCGTTGA
Gene >Hirsu2|2692
ATGGGCCAGGGCCGGTCAAACATCAGCTCCTCACCCATCTTGCGGGCCATCGTCTTGGCCCTCTTTCTCTCCTTC
TCCGTCACATCAGCCTCGGCCGCACCTCCTCAGAGCCCCCCCGGAGAAGTCATCTGTTCTCCTTCGGACCCCCAA
GACTGCTATCCCCGGACCTTCCATCCAACGGACAAGTTCCAGGTCGTGCGCGAGGGCCAAGACATCCCCCCCGGA
TTGCACGTGCGGCTCAACATCACGACGGGCCTGAAGGAGGCCAAGATCAACGTCCCCGGCGAGTCGGACTCGTCC
CTCAACGGCCTGCCCATCGACGGGTCGCTTGTTGTTTCCCCCCAGCCGGATGACGACGGCCAACAGACGCCCAAG
GGCGCGCCGGCATACGACCCCGTCGGCAAGATCAAGAAGCCCCAGCAGGAATCCGAGTCCTTCACGGCAGCCACG
AAGATGCTTCGCGAAGGCAACCTTCGCCACAACCATGCCGTCGACGAGTCTCTCGACGGCCTCGACGAGCTCTCT
CACGACATGTACTACGGCTTGAAGATCGCCGAGGACACCGAGGTCGTCCGCGCCCTCTTCTGCCTCATGGTCAGT
CAACACGTGCCCGTGAGCACCGGTAGCTTCATCCCCCGTGACCTGCGCGCCGCCTCCATCCTCGTCGGCACCCTC
TCCAACAACCCCCCGGCCCGGAACAAGGTGGCCGACGCCTGGCCCGAGCTGAGGGACGGCCACTGCCCCAAGAGC
GACCTGACGCTCGGCCAGGCCTTGTTCGACAGCCTCGTCCCGACCGGGAGCAAAGATGCGGCCGACGTCAAGAAG
TCGGCCGCGTCCATCAAGGCCATAGTCCCGGTCGTCAACGACCTCCTCAAGAACGACAAGATGCGGGCCGAATTC
CTCGCCCAGGGCGGCATGGAGCGGCTCCTCCAGGTCTTGGTCCTCGAGGGGCACGAGTGGGCCGGCGCGCAGCGC
AAGGTCGGACAGCTCGCCCTCGACAACTTCCTCGACGCCGACATGGGCGCCAAACTGGGACAGTGGCCCACGGCG
CCGAGTCTGGACGACAGGCAATGCCGGTCGGCCGGGCGCAGCCCCCCGGACGGCTGCTGGGACCACCACGTCGCC
AGGATCGCCGAGGCCAACAAGCACCAGCAGGGCCACTGGAGCACCGACCTGCACGACAAGCTGTCGGCGGCGCGC
AAGGCTTCCGGCTCCGGCCAGGCCCCCGGCAGCCCCTACGACTCGGGCATGGCTCACAGCAGCGACGCCGAGTCC
AGCGAGGAAGCCAAGGACCAACCCGACGGCGCTGGCGAGACGCAGCACAAGCTTTCCGGCCCTGGTGAGGCTCCG
CGCCCCGAACTGTAGAAGAGCATGACTGAGTGCAGCTCAGGGCCGTCGCCGTATTACTTCTTTTACCTTTTGCTG
GTCGTGACCGTCGGCGTTTGCGTGCTGCATACCTTGGGGTTTTCGGTGTTGGGCGCATTCCGCCGCCTGCTGTCG
CGTCGTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail