Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|269
Gene name
LocationContig_105:19794..22043
Strand+
Gene length (bp)2249
Transcript length (bp)2187
Coding sequence length (bp)2187
Protein length (aa) 729

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00728 Glyco_hydro_20 Glycosyl hydrolase family 20, catalytic domain 2.1E-23 182 342
PF02838 Glyco_hydro_20b Glycosyl hydrolase family 20, domain 2 5.4E-07 74 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 118 300 6.0E-17
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 128 340 2.0E-15
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 84 510 9.0E-14
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 126 293 7.0E-13
sp|Q7WUL4|HEX20_CELFI Beta-N-acetylhexosaminidase OS=Cellulomonas fimi GN=hex20 PE=1 SV=1 127 416 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P49008|HEXA_PORGI Beta-hexosaminidase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nahA PE=3 SV=2 118 300 6.0E-17
sp|P96155|HEX1_VIBFU Beta-hexosaminidase OS=Vibrio furnissii GN=exo I PE=1 SV=1 128 340 2.0E-15
sp|P43077|HEX1_CANAX Beta-hexosaminidase OS=Candida albicans GN=HEX1 PE=1 SV=1 84 510 9.0E-14
sp|Q04786|HEX_VIBVL Beta-hexosaminidase OS=Vibrio vulnificus GN=hex PE=3 SV=1 126 293 7.0E-13
sp|Q7WUL4|HEX20_CELFI Beta-N-acetylhexosaminidase OS=Cellulomonas fimi GN=hex20 PE=1 SV=1 127 416 2.0E-12
sp|P06865|HEXA_HUMAN Beta-hexosaminidase subunit alpha OS=Homo sapiens GN=HEXA PE=1 SV=2 127 512 2.0E-11
sp|Q5RC84|HEXA_PONAB Beta-hexosaminidase subunit alpha OS=Pongo abelii GN=HEXA PE=3 SV=1 127 512 3.0E-11
sp|P13723|HEXA1_DICDI Beta-hexosaminidase subunit A1 OS=Dictyostelium discoideum GN=hexa1 PE=1 SV=1 127 340 5.0E-10
sp|D4AYT4|HEX2_ARTBC Probable beta-hexosaminidase ARB_01353 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01353 PE=1 SV=1 127 514 7.0E-10
sp|Q8L7S6|HEXO3_ARATH Beta-hexosaminidase 3 OS=Arabidopsis thaliana GN=HEXO3 PE=1 SV=1 175 340 2.0E-09
sp|A7WM73|HEXO1_ARATH Beta-hexosaminidase 1 OS=Arabidopsis thaliana GN=HEXO1 PE=1 SV=1 175 288 5.0E-09
sp|Q0V8R6|HEXA_BOVIN Beta-hexosaminidase subunit alpha OS=Bos taurus GN=HEXA PE=2 SV=1 127 526 9.0E-09
sp|Q86M34|HEXB_ENTHI Beta-hexosaminidase subunit beta OS=Entamoeba histolytica GN=HEXB PE=1 SV=1 88 287 9.0E-09
sp|E9DFH0|HEX1_COCPS Beta-hexosaminidase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=HEX1 PE=1 SV=1 125 513 1.0E-08
sp|P29416|HEXA_MOUSE Beta-hexosaminidase subunit alpha OS=Mus musculus GN=Hexa PE=1 SV=2 127 526 6.0E-08
sp|Q641X3|HEXA_RAT Beta-hexosaminidase subunit alpha OS=Rattus norvegicus GN=Hexa PE=2 SV=1 127 526 9.0E-08
sp|Q8WSF3|FDL_DROME Probable beta-hexosaminidase fdl OS=Drosophila melanogaster GN=fdl PE=1 SV=1 127 300 6.0E-07
sp|P49007|HEXB_PSEO7 Beta-hexosaminidase B OS=Pseudoalteromonas piscicida GN=nag096 PE=3 SV=1 110 288 8.0E-07
sp|P49614|HEXB_FELCA Beta-hexosaminidase subunit beta OS=Felis catus GN=HEXB PE=2 SV=2 125 288 3.0E-06
sp|P07686|HEXB_HUMAN Beta-hexosaminidase subunit beta OS=Homo sapiens GN=HEXB PE=1 SV=3 175 362 4.0E-06
sp|Q54K56|HEXB2_DICDI Beta-hexosaminidase subunit B2 OS=Dictyostelium discoideum GN=hexb2 PE=3 SV=1 175 311 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|269
MKADFLLAVVATPLIAFWGHENGLASANLLGIPSVPYRETEPKWFELSKLEGIRVDARYASARDEDGATLIPPTL
RDFAATFADDLQTVFGIRTGVIESDGAGIDSIFLTLGDKSSYTDAAGRPTSEGYSLTSNESGIFITGASPLGVWW
GTRTVLQQAALRKDAPGLPYGSGDDMPAWGERGMMLDAGRHYYPKDFLVELCSYMSFFKQNIFHLHLSDNLFVNR
AYSRQQALRLDAWFRLWSDNAELSGLNTRRNESYTRADFEDIQARCAARGVTVIPEIEAPGHALPIVQWRPQLGL
PSDLSLLNISHPETIPTMKMIWREFLPWFHSKTVSIGADEYTGPVRDYNRLVNAMDDFIREESGKSIRIWGTFPP
RTTPGYNNIHKDVSIQHWKFAEDNPYRDYIRNNYSVVNSNGDFYVVAKWGGYPNAIDIAKTFHGDPAVKGGGLWY
PNMFSQEKASDNPPRHEPLVLGAIAPLWNDFGSNATVYSEAYYAWRQGIPALADKHWGGNLSRQQFDSVFPQLHP
FVPAQNLDRRIPSRGDVIFEYDLGQGVESYGKVVKDRSPNGYDATTNCESQGSSLLITPDCSLQTPWSSKGRDYS
LSLQLKIDELPGTTNTTLVAGSDSVLMLTPGITLLASGNYYRLKSTVPLRNWVELSIRGRGAQTFASVRPLSQKT
PAKEEEFRTKMGINGRSFHWDVMAIEAPIKEVTGWKGELRRFRLTNRGTGGHA*
Coding >Hirsu2|269
ATGAAGGCCGACTTCCTACTAGCGGTCGTAGCGACGCCGCTTATCGCCTTCTGGGGCCACGAGAACGGTCTTGCC
TCGGCAAACCTCCTCGGGATACCCTCTGTGCCCTACCGTGAAACGGAGCCAAAGTGGTTCGAACTGTCAAAGCTC
GAGGGCATCAGAGTTGATGCTCGGTATGCCTCGGCTCGAGACGAGGATGGAGCCACGCTGATCCCCCCTACCCTG
CGTGACTTCGCCGCCACATTTGCCGACGACTTACAGACCGTCTTCGGCATCCGGACTGGGGTCATAGAAAGCGAT
GGCGCGGGGATAGACAGCATATTTCTGACCTTGGGCGACAAGTCGTCCTACACAGACGCCGCCGGCCGCCCCACG
TCCGAGGGCTACAGCCTGACGTCGAACGAGTCCGGCATCTTCATCACCGGAGCCAGCCCGCTCGGCGTCTGGTGG
GGCACCCGGACCGTCCTGCAGCAGGCGGCCCTGCGAAAGGATGCCCCTGGCCTGCCGTACGGCTCGGGCGACGAC
ATGCCGGCCTGGGGCGAGCGCGGCATGATGCTCGACGCCGGCCGGCACTACTACCCCAAGGACTTCCTCGTCGAG
CTGTGCTCCTACATGTCCTTCTTCAAGCAGAACATCTTCCACCTGCACCTCAGCGACAACCTCTTTGTCAACCGG
GCCTACTCGCGGCAGCAGGCGCTCCGGCTCGACGCCTGGTTCCGGCTCTGGTCCGACAACGCCGAGCTCAGCGGC
CTAAACACGCGCCGCAACGAGTCGTACACGCGCGCCGACTTTGAAGACATCCAGGCCCGCTGTGCCGCCCGCGGC
GTGACCGTCATCCCCGAGATCGAGGCGCCCGGGCACGCGCTGCCCATCGTGCAGTGGCGGCCCCAGCTCGGCCTG
CCCAGCGACCTGAGCCTCCTCAACATCTCCCATCCGGAGACTATACCGACCATGAAAATGATCTGGCGGGAGTTC
CTGCCCTGGTTCCACTCCAAGACGGTCTCTATCGGAGCAGATGAGTACACGGGGCCCGTCCGGGACTACAACCGG
CTCGTCAACGCCATGGACGACTTCATCCGGGAGGAGTCGGGCAAATCGATCCGTATCTGGGGCACCTTCCCGCCT
CGCACTACCCCAGGATACAACAACATACACAAAGACGTGTCGATCCAGCATTGGAAGTTCGCCGAGGACAATCCG
TACCGCGACTACATCCGCAACAACTACTCGGTCGTGAACTCCAACGGGGACTTCTACGTCGTCGCCAAGTGGGGA
GGGTATCCCAATGCCATAGACATCGCCAAGACGTTCCATGGCGATCCCGCCGTCAAGGGCGGCGGCCTCTGGTAT
CCCAACATGTTCAGCCAGGAGAAGGCATCGGATAACCCGCCGCGCCACGAGCCTCTGGTCCTCGGTGCCATCGCG
CCGCTCTGGAACGACTTCGGCTCCAACGCCACCGTCTACTCCGAGGCCTACTACGCCTGGCGCCAAGGTATACCG
GCTTTGGCGGACAAACACTGGGGCGGGAACTTGAGCCGGCAGCAGTTCGACAGCGTCTTCCCCCAGCTGCACCCG
TTCGTCCCGGCACAAAATCTCGACCGGAGGATTCCATCCAGGGGAGACGTCATCTTCGAATACGATCTGGGGCAA
GGCGTCGAGTCTTACGGAAAAGTAGTGAAAGACAGGTCGCCCAACGGATACGATGCCACGACGAATTGCGAGTCG
CAGGGCTCGTCCCTGCTCATTACGCCGGACTGCTCGCTGCAGACTCCGTGGTCGTCCAAGGGAAGGGACTACTCT
CTCTCCTTGCAGCTCAAGATTGACGAGCTACCGGGAACCACGAACACAACACTCGTGGCTGGGTCGGACTCCGTT
TTGATGCTGACTCCGGGCATCACCCTCTTGGCGTCTGGGAACTACTATCGGCTGAAAAGCACCGTGCCCCTGAGA
AATTGGGTTGAGCTGAGCATACGAGGACGGGGAGCTCAGACATTTGCTTCAGTCAGGCCGCTTAGCCAGAAGACA
CCTGCGAAAGAGGAGGAGTTCCGCACAAAGATGGGCATCAATGGGCGAAGTTTCCACTGGGACGTCATGGCTATC
GAGGCGCCAATCAAGGAGGTCACGGGCTGGAAAGGCGAGCTACGAAGATTCCGCCTAACTAACCGCGGCACCGGA
GGACATGCTTGA
Transcript >Hirsu2|269
ATGAAGGCCGACTTCCTACTAGCGGTCGTAGCGACGCCGCTTATCGCCTTCTGGGGCCACGAGAACGGTCTTGCC
TCGGCAAACCTCCTCGGGATACCCTCTGTGCCCTACCGTGAAACGGAGCCAAAGTGGTTCGAACTGTCAAAGCTC
GAGGGCATCAGAGTTGATGCTCGGTATGCCTCGGCTCGAGACGAGGATGGAGCCACGCTGATCCCCCCTACCCTG
CGTGACTTCGCCGCCACATTTGCCGACGACTTACAGACCGTCTTCGGCATCCGGACTGGGGTCATAGAAAGCGAT
GGCGCGGGGATAGACAGCATATTTCTGACCTTGGGCGACAAGTCGTCCTACACAGACGCCGCCGGCCGCCCCACG
TCCGAGGGCTACAGCCTGACGTCGAACGAGTCCGGCATCTTCATCACCGGAGCCAGCCCGCTCGGCGTCTGGTGG
GGCACCCGGACCGTCCTGCAGCAGGCGGCCCTGCGAAAGGATGCCCCTGGCCTGCCGTACGGCTCGGGCGACGAC
ATGCCGGCCTGGGGCGAGCGCGGCATGATGCTCGACGCCGGCCGGCACTACTACCCCAAGGACTTCCTCGTCGAG
CTGTGCTCCTACATGTCCTTCTTCAAGCAGAACATCTTCCACCTGCACCTCAGCGACAACCTCTTTGTCAACCGG
GCCTACTCGCGGCAGCAGGCGCTCCGGCTCGACGCCTGGTTCCGGCTCTGGTCCGACAACGCCGAGCTCAGCGGC
CTAAACACGCGCCGCAACGAGTCGTACACGCGCGCCGACTTTGAAGACATCCAGGCCCGCTGTGCCGCCCGCGGC
GTGACCGTCATCCCCGAGATCGAGGCGCCCGGGCACGCGCTGCCCATCGTGCAGTGGCGGCCCCAGCTCGGCCTG
CCCAGCGACCTGAGCCTCCTCAACATCTCCCATCCGGAGACTATACCGACCATGAAAATGATCTGGCGGGAGTTC
CTGCCCTGGTTCCACTCCAAGACGGTCTCTATCGGAGCAGATGAGTACACGGGGCCCGTCCGGGACTACAACCGG
CTCGTCAACGCCATGGACGACTTCATCCGGGAGGAGTCGGGCAAATCGATCCGTATCTGGGGCACCTTCCCGCCT
CGCACTACCCCAGGATACAACAACATACACAAAGACGTGTCGATCCAGCATTGGAAGTTCGCCGAGGACAATCCG
TACCGCGACTACATCCGCAACAACTACTCGGTCGTGAACTCCAACGGGGACTTCTACGTCGTCGCCAAGTGGGGA
GGGTATCCCAATGCCATAGACATCGCCAAGACGTTCCATGGCGATCCCGCCGTCAAGGGCGGCGGCCTCTGGTAT
CCCAACATGTTCAGCCAGGAGAAGGCATCGGATAACCCGCCGCGCCACGAGCCTCTGGTCCTCGGTGCCATCGCG
CCGCTCTGGAACGACTTCGGCTCCAACGCCACCGTCTACTCCGAGGCCTACTACGCCTGGCGCCAAGGTATACCG
GCTTTGGCGGACAAACACTGGGGCGGGAACTTGAGCCGGCAGCAGTTCGACAGCGTCTTCCCCCAGCTGCACCCG
TTCGTCCCGGCACAAAATCTCGACCGGAGGATTCCATCCAGGGGAGACGTCATCTTCGAATACGATCTGGGGCAA
GGCGTCGAGTCTTACGGAAAAGTAGTGAAAGACAGGTCGCCCAACGGATACGATGCCACGACGAATTGCGAGTCG
CAGGGCTCGTCCCTGCTCATTACGCCGGACTGCTCGCTGCAGACTCCGTGGTCGTCCAAGGGAAGGGACTACTCT
CTCTCCTTGCAGCTCAAGATTGACGAGCTACCGGGAACCACGAACACAACACTCGTGGCTGGGTCGGACTCCGTT
TTGATGCTGACTCCGGGCATCACCCTCTTGGCGTCTGGGAACTACTATCGGCTGAAAAGCACCGTGCCCCTGAGA
AATTGGGTTGAGCTGAGCATACGAGGACGGGGAGCTCAGACATTTGCTTCAGTCAGGCCGCTTAGCCAGAAGACA
CCTGCGAAAGAGGAGGAGTTCCGCACAAAGATGGGCATCAATGGGCGAAGTTTCCACTGGGACGTCATGGCTATC
GAGGCGCCAATCAAGGAGGTCACGGGCTGGAAAGGCGAGCTACGAAGATTCCGCCTAACTAACCGCGGCACCGGA
GGACATGCTTGA
Gene >Hirsu2|269
ATGAAGGCCGACTTCCTACTAGCGGTCGTAGCGACGCCGCTTATCGCCTTCTGGGGCCACGAGAACGGTAGGCCA
AGACACCGATTGCTCTACAGACCCGTCCGGCTCAGTCACTTGTCTCATTCGCAGGTCTTGCCTCGGCAAACCTCC
TCGGGATACCCTCTGTGCCCTACCGTGAAACGGAGCCAAAGTGGTTCGAACTGTCAAAGCTCGAGGGCATCAGAG
TTGATGCTCGGTATGCCTCGGCTCGAGACGAGGATGGAGCCACGCTGATCCCCCCTACCCTGCGTGACTTCGCCG
CCACATTTGCCGACGACTTACAGACCGTCTTCGGCATCCGGACTGGGGTCATAGAAAGCGATGGCGCGGGGATAG
ACAGCATATTTCTGACCTTGGGCGACAAGTCGTCCTACACAGACGCCGCCGGCCGCCCCACGTCCGAGGGCTACA
GCCTGACGTCGAACGAGTCCGGCATCTTCATCACCGGAGCCAGCCCGCTCGGCGTCTGGTGGGGCACCCGGACCG
TCCTGCAGCAGGCGGCCCTGCGAAAGGATGCCCCTGGCCTGCCGTACGGCTCGGGCGACGACATGCCGGCCTGGG
GCGAGCGCGGCATGATGCTCGACGCCGGCCGGCACTACTACCCCAAGGACTTCCTCGTCGAGCTGTGCTCCTACA
TGTCCTTCTTCAAGCAGAACATCTTCCACCTGCACCTCAGCGACAACCTCTTTGTCAACCGGGCCTACTCGCGGC
AGCAGGCGCTCCGGCTCGACGCCTGGTTCCGGCTCTGGTCCGACAACGCCGAGCTCAGCGGCCTAAACACGCGCC
GCAACGAGTCGTACACGCGCGCCGACTTTGAAGACATCCAGGCCCGCTGTGCCGCCCGCGGCGTGACCGTCATCC
CCGAGATCGAGGCGCCCGGGCACGCGCTGCCCATCGTGCAGTGGCGGCCCCAGCTCGGCCTGCCCAGCGACCTGA
GCCTCCTCAACATCTCCCATCCGGAGACTATACCGACCATGAAAATGATCTGGCGGGAGTTCCTGCCCTGGTTCC
ACTCCAAGACGGTCTCTATCGGAGCAGATGAGTACACGGGGCCCGTCCGGGACTACAACCGGCTCGTCAACGCCA
TGGACGACTTCATCCGGGAGGAGTCGGGCAAATCGATCCGTATCTGGGGCACCTTCCCGCCTCGCACTACCCCAG
GATACAACAACATACACAAAGACGTGTCGATCCAGCATTGGAAGTTCGCCGAGGACAATCCGTACCGCGACTACA
TCCGCAACAACTACTCGGTCGTGAACTCCAACGGGGACTTCTACGTCGTCGCCAAGTGGGGAGGGTATCCCAATG
CCATAGACATCGCCAAGACGTTCCATGGCGATCCCGCCGTCAAGGGCGGCGGCCTCTGGTATCCCAACATGTTCA
GCCAGGAGAAGGCATCGGATAACCCGCCGCGCCACGAGCCTCTGGTCCTCGGTGCCATCGCGCCGCTCTGGAACG
ACTTCGGCTCCAACGCCACCGTCTACTCCGAGGCCTACTACGCCTGGCGCCAAGGTATACCGGCTTTGGCGGACA
AACACTGGGGCGGGAACTTGAGCCGGCAGCAGTTCGACAGCGTCTTCCCCCAGCTGCACCCGTTCGTCCCGGCAC
AAAATCTCGACCGGAGGATTCCATCCAGGGGAGACGTCATCTTCGAATACGATCTGGGGCAAGGCGTCGAGTCTT
ACGGAAAAGTAGTGAAAGACAGGTCGCCCAACGGATACGATGCCACGACGAATTGCGAGTCGCAGGGCTCGTCCC
TGCTCATTACGCCGGACTGCTCGCTGCAGACTCCGTGGTCGTCCAAGGGAAGGGACTACTCTCTCTCCTTGCAGC
TCAAGATTGACGAGCTACCGGGAACCACGAACACAACACTCGTGGCTGGGTCGGACTCCGTTTTGATGCTGACTC
CGGGCATCACCCTCTTGGCGTCTGGGAACTACTATCGGCTGAAAAGCACCGTGCCCCTGAGAAATTGGGTTGAGC
TGAGCATACGAGGACGGGGAGCTCAGACATTTGCTTCAGTCAGGCCGCTTAGCCAGAAGACACCTGCGAAAGAGG
AGGAGTTCCGCACAAAGATGGGCATCAATGGGCGAAGTTTCCACTGGGACGTCATGGCTATCGAGGCGCCAATCA
AGGAGGTCACGGGCTGGAAAGGCGAGCTACGAAGATTCCGCCTAACTAACCGCGGCACCGGAGGACATGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail