Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2681
Gene name
LocationContig_165:24283..25713
Strand+
Gene length (bp)1430
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 3.7E-12 263 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 259 410 5.0E-12
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 259 410 4.0E-10
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 264 392 1.0E-09
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 263 391 1.0E-08
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 263 410 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 259 410 5.0E-12
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 259 410 4.0E-10
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 264 392 1.0E-09
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 263 391 1.0E-08
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 263 410 3.0E-08
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 262 410 4.0E-08
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 262 405 5.0E-08
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 262 405 8.0E-08
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 259 410 3.0E-07
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 265 410 4.0E-07
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 262 406 8.0E-07
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 262 406 8.0E-07
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 262 404 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0004175 endopeptidase activity No
GO:0071704 organic substance metabolic process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008236 serine-type peptidase activity No
GO:0003674 molecular_function No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2681
MLLLQSTFSSTQRVDRFGLELVDYLEAQEQQTAYLLNAILRDEEAHLFRDLGAPGILRQVAVQLLQTIRPQNAAE
VLATTVERFQQSASDPEWFDTLIVLLEYVPCAWIVIDLALLGDRLGDAQTWPSDFQQLFDRLRAKGSSALLKVAL
LNCRDVLSGSVSAHVVSVPEMPTLPSMTRALQRQRLQEQGSNHHFQPPLHRPPQFEQSLTVSEPDTIALNGDVAA
GGEKADSKQCQDWFAKMRAFQKCVDAFRKDPDEKCPRVKVAVLDTGVDLSHPEIAEARADERLLYHDFVDSADGI
GDLDGHGTHCTSILLKHAPNAQVYSGRVFRRSRADKDSPVIVAKAISHAADVWKVDIISLSLGFESSAGVMRDAI
RQACARNILIFAAAANNTTNEVTPIRFPARLDEPVMG*
Coding >Hirsu2|2681
ATGCTCCTTTTGCAGAGCACCTTCTCGTCGACACAACGCGTCGACAGATTCGGCCTCGAGCTGGTTGACTATCTC
GAGGCCCAAGAGCAGCAGACGGCTTACTTGCTCAACGCAATCTTGCGTGACGAGGAGGCTCATCTGTTCCGCGAC
CTTGGCGCGCCAGGCATCTTGCGCCAGGTTGCGGTGCAGCTTCTCCAGACGATACGGCCCCAGAATGCTGCCGAG
GTTCTCGCTACCACAGTCGAACGGTTCCAACAGTCGGCAAGCGATCCAGAATGGTTTGACACCCTGATCGTGTTG
CTTGAGTACGTTCCCTGCGCCTGGATAGTGATTGATCTTGCACTCCTGGGCGATCGGCTCGGGGATGCACAGACT
TGGCCCTCCGACTTTCAGCAGTTGTTTGATCGGCTGCGGGCTAAAGGCTCCTCGGCCTTGTTGAAAGTCGCGCTT
CTCAACTGCCGGGACGTCTTGTCCGGCTCCGTGTCGGCCCATGTCGTCTCGGTTCCGGAGATGCCTACTCTGCCC
TCCATGACGCGGGCCTTACAGAGACAGCGGTTGCAGGAACAGGGCTCGAATCATCACTTCCAGCCCCCTCTTCAT
CGTCCTCCCCAATTCGAACAGAGCTTGACTGTCTCGGAGCCAGACACCATCGCACTCAACGGTGATGTGGCTGCT
GGCGGTGAGAAGGCCGACAGCAAGCAGTGCCAGGATTGGTTTGCCAAAATGAGGGCCTTTCAGAAATGTGTTGAT
GCGTTCAGAAAGGATCCCGACGAGAAGTGCCCCCGTGTCAAGGTGGCCGTGCTGGACACGGGCGTCGACCTATCG
CACCCTGAAATAGCTGAGGCCCGGGCAGATGAACGCTTGTTGTACCATGATTTTGTCGATTCAGCGGACGGGATC
GGCGACTTGGACGGACATGGAACTCACTGTACCTCCATTCTGCTCAAACATGCCCCCAATGCCCAAGTATATAGC
GGCCGCGTCTTCAGACGCAGCCGGGCAGACAAGGACAGCCCCGTCATCGTGGCCAAGGCTATTTCTCACGCTGCA
GACGTCTGGAAGGTCGACATTATCTCGCTCTCTCTCGGATTTGAGTCTTCTGCTGGCGTCATGCGCGATGCCATC
AGACAAGCCTGTGCCAGAAACATCTTGATCTTCGCAGCAGCGGCCAACAACACGACAAACGAAGTAACGCCCATC
AGATTCCCGGCGAGACTGGACGAGCCCGTCATGGGCTGA
Transcript >Hirsu2|2681
ATGCTCCTTTTGCAGAGCACCTTCTCGTCGACACAACGCGTCGACAGATTCGGCCTCGAGCTGGTTGACTATCTC
GAGGCCCAAGAGCAGCAGACGGCTTACTTGCTCAACGCAATCTTGCGTGACGAGGAGGCTCATCTGTTCCGCGAC
CTTGGCGCGCCAGGCATCTTGCGCCAGGTTGCGGTGCAGCTTCTCCAGACGATACGGCCCCAGAATGCTGCCGAG
GTTCTCGCTACCACAGTCGAACGGTTCCAACAGTCGGCAAGCGATCCAGAATGGTTTGACACCCTGATCGTGTTG
CTTGAGTACGTTCCCTGCGCCTGGATAGTGATTGATCTTGCACTCCTGGGCGATCGGCTCGGGGATGCACAGACT
TGGCCCTCCGACTTTCAGCAGTTGTTTGATCGGCTGCGGGCTAAAGGCTCCTCGGCCTTGTTGAAAGTCGCGCTT
CTCAACTGCCGGGACGTCTTGTCCGGCTCCGTGTCGGCCCATGTCGTCTCGGTTCCGGAGATGCCTACTCTGCCC
TCCATGACGCGGGCCTTACAGAGACAGCGGTTGCAGGAACAGGGCTCGAATCATCACTTCCAGCCCCCTCTTCAT
CGTCCTCCCCAATTCGAACAGAGCTTGACTGTCTCGGAGCCAGACACCATCGCACTCAACGGTGATGTGGCTGCT
GGCGGTGAGAAGGCCGACAGCAAGCAGTGCCAGGATTGGTTTGCCAAAATGAGGGCCTTTCAGAAATGTGTTGAT
GCGTTCAGAAAGGATCCCGACGAGAAGTGCCCCCGTGTCAAGGTGGCCGTGCTGGACACGGGCGTCGACCTATCG
CACCCTGAAATAGCTGAGGCCCGGGCAGATGAACGCTTGTTGTACCATGATTTTGTCGATTCAGCGGACGGGATC
GGCGACTTGGACGGACATGGAACTCACTGTACCTCCATTCTGCTCAAACATGCCCCCAATGCCCAAGTATATAGC
GGCCGCGTCTTCAGACGCAGCCGGGCAGACAAGGACAGCCCCGTCATCGTGGCCAAGGCTATTTCTCACGCTGCA
GACGTCTGGAAGGTCGACATTATCTCGCTCTCTCTCGGATTTGAGTCTTCTGCTGGCGTCATGCGCGATGCCATC
AGACAAGCCTGTGCCAGAAACATCTTGATCTTCGCAGCAGCGGCCAACAACACGACAAACGAAGTAACGCCCATC
AGATTCCCGGCGAGACTGGACGAGCCCGTCATGGGCTGA
Gene >Hirsu2|2681
ATGCTCCTTTTGCAGAGCACCTTCTCGTCGACACAACGCGTCGACAGATTCGGCCTCGAGCTGGTTGACTATCTC
GAGGCCCAAGAGCAGCAGACGGCTTACTTGCTCAACGCAATCTTGCGTGACGAGGAGGCTCATCTGTTCCGCGAC
CTTGGCGCGCCAGGCATCTTGCGCCAGGTTGCGGTGCAGCTTCTCCAGACGATACGGCCCCAGAATGCTGCCGAG
GTTCTCGCTACCACAGTCGAACGGTTCCAACAGTCGGCAAGCGATCCAGAATGGTTTGACACCCTGATCGTGTTG
CTTGAGTACGTTCCCTGCGCCTGGATAGTGATTGATCTTGCACTCCTGGGCGATCGGCTCGGGGATGCACAGACT
TGGCCCTCCGACTTTCAGCAGTTGTTTGATCGGCTGCGGGCTAAAGGCTCCTCGGCCTTGTTGAAAGTCGCGCTT
CTCAACTGCCGGGACGTCTTGTCCGGCTCCGTGTCGGCCCATGTCGTCTCGGTTCCGGAGATGCCTACTCTGCCC
TCCATGACGCGGGCCTTACAGAGACAGCGGTTGCAGGAACAGGGCTCGAATCATCACTTCCAGCCCCCTCTTCAT
CGTCCTCCCCAATTCGAACAGAGCTTGACTGTCTCGGAGCCAGACACCATCGCACTCAACGGTGATGTGGCTGCT
GGCGGTGAGAAGGCCGAGTAAGAGACCGATCCTAGCTGTGCTGCCTTGGCCTTTTTTGGGCTTCCTTCTGACCAG
CTCACCCCATCAGCAGCAAGCAGTGCCAGGATTGGTTTGCCAAAATGAGGGCCTTTCAGAAATGTGTTGATGCGT
TCAGAAAGGATCCCGACGAGAAGTGCCCCCGTGTCAAGGTGGCCGTGCTGGACACGGGCGTCGACCTATCGCACC
CTGAAATAGCTGAGGCCCGGGCAGATGAACGCTTGTTGTACCATGATTTTGTCGATTCAGCGGACGGGATCGGCG
ACTTGGACGGACATGGAACTCACTGTACCTCCATTCTGCTCAAACATGCCCCCAATGCCCAAGTATATAGCGGCC
GCGTCTTCAGACGCAGCCGGGCAGACAAGGACAGCCCCGTCATCGTGGCCAAGGTCAGCCACAGCAGGCGTTCAT
TGAAACTTCGATTCACAGCGGCTGACAGGTTTTGCAGGCTATTTCTCACGCTGCAGACGTCTGGAAGGTCGACAT
TATCTCGCTCTCTCTCGGATTTGAGTCTTCTGCTGGCGTCATGCGCGATGCCATCAGACAAGCCTGTGCCAGAAA
CATCTTGATCTTCGCAGCAGCGGCCAACAACACGACAAACGAAGTAACGCCCATCAGATTCCCGGCGAGACTGGA
CGAGGTAATCTGCGTCTTCGCCTCCGACTCCTTTGGCCGGCCTTCACGGTTCAATCCGCCGCCAGCCCGTCATGG
GCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail