Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2681
Gene name
LocationContig_165:24283..25713
Strand+
Gene length (bp)1430
Transcript length (bp)1239
Coding sequence length (bp)1239
Protein length (aa) 413

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 1.4E-16 263 405

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 259 410 5.0E-12
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 259 410 4.0E-10
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 264 392 1.0E-09
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 263 391 1.0E-08
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 263 410 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 259 410 5.0E-12
sp|P00781|SUBD_BACLI Subtilisin DY OS=Bacillus licheniformis GN=apr PE=1 SV=1 259 410 4.0E-10
sp|Q45670|THES_BACSJ Thermophilic serine proteinase OS=Bacillus sp. (strain AK1) PE=1 SV=1 264 392 1.0E-09
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 263 391 1.0E-08
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 263 410 3.0E-08
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 262 410 4.0E-08
sp|P04189|SUBT_BACSU Subtilisin E OS=Bacillus subtilis (strain 168) GN=aprE PE=1 SV=3 262 405 5.0E-08
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 262 405 8.0E-08
sp|P00780|SUBT_BACLI Subtilisin Carlsberg OS=Bacillus licheniformis GN=apr PE=1 SV=1 259 410 3.0E-07
sp|P29140|ISP_BACCS Intracellular alkaline protease OS=Bacillus clausii PE=3 SV=1 265 410 4.0E-07
sp|P00783|SUBT_BACSA Subtilisin amylosacchariticus OS=Bacillus subtilis subsp. amylosacchariticus GN=apr PE=1 SV=2 262 406 8.0E-07
sp|P29142|SUBT_GEOSE Subtilisin J OS=Geobacillus stearothermophilus GN=aprJ PE=3 SV=1 262 406 8.0E-07
sp|P16396|SUBE_BACSU Minor extracellular protease Epr OS=Bacillus subtilis (strain 168) GN=epr PE=2 SV=1 262 404 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:1901564 organonitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.653 0.3176 0.7835 0.1001 0.2319 0.0536 0.1707 0.1249 0.0833 0.1021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup86
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1184
Ophiocordyceps australis 1348a (Ghana) OphauG2|263
Ophiocordyceps australis 1348a (Ghana) OphauG2|3360
Ophiocordyceps australis 1348a (Ghana) OphauG2|4814
Ophiocordyceps australis map64 (Brazil) OphauB2|648
Ophiocordyceps camponoti-floridani Ophcf2|05313
Ophiocordyceps camponoti-rufipedis Ophun1|5265
Ophiocordyceps camponoti-rufipedis Ophun1|5266
Ophiocordyceps camponoti-rufipedis Ophun1|5812
Ophiocordyceps camponoti-rufipedis Ophun1|5813
Ophiocordyceps kimflemingae Ophio5|1142
Ophiocordyceps kimflemingae Ophio5|3577
Ophiocordyceps kimflemingae Ophio5|7208
Ophiocordyceps subramaniannii Hirsu2|2681 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9393
Ophiocordyceps subramaniannii Hirsu2|9999

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2681
MLLLQSTFSSTQRVDRFGLELVDYLEAQEQQTAYLLNAILRDEEAHLFRDLGAPGILRQVAVQLLQTIRPQNAAE
VLATTVERFQQSASDPEWFDTLIVLLEYVPCAWIVIDLALLGDRLGDAQTWPSDFQQLFDRLRAKGSSALLKVAL
LNCRDVLSGSVSAHVVSVPEMPTLPSMTRALQRQRLQEQGSNHHFQPPLHRPPQFEQSLTVSEPDTIALNGDVAA
GGEKADSKQCQDWFAKMRAFQKCVDAFRKDPDEKCPRVKVAVLDTGVDLSHPEIAEARADERLLYHDFVDSADGI
GDLDGHGTHCTSILLKHAPNAQVYSGRVFRRSRADKDSPVIVAKAISHAADVWKVDIISLSLGFESSAGVMRDAI
RQACARNILIFAAAANNTTNEVTPIRFPARLDEPVMG*
Coding >Hirsu2|2681
ATGCTCCTTTTGCAGAGCACCTTCTCGTCGACACAACGCGTCGACAGATTCGGCCTCGAGCTGGTTGACTATCTC
GAGGCCCAAGAGCAGCAGACGGCTTACTTGCTCAACGCAATCTTGCGTGACGAGGAGGCTCATCTGTTCCGCGAC
CTTGGCGCGCCAGGCATCTTGCGCCAGGTTGCGGTGCAGCTTCTCCAGACGATACGGCCCCAGAATGCTGCCGAG
GTTCTCGCTACCACAGTCGAACGGTTCCAACAGTCGGCAAGCGATCCAGAATGGTTTGACACCCTGATCGTGTTG
CTTGAGTACGTTCCCTGCGCCTGGATAGTGATTGATCTTGCACTCCTGGGCGATCGGCTCGGGGATGCACAGACT
TGGCCCTCCGACTTTCAGCAGTTGTTTGATCGGCTGCGGGCTAAAGGCTCCTCGGCCTTGTTGAAAGTCGCGCTT
CTCAACTGCCGGGACGTCTTGTCCGGCTCCGTGTCGGCCCATGTCGTCTCGGTTCCGGAGATGCCTACTCTGCCC
TCCATGACGCGGGCCTTACAGAGACAGCGGTTGCAGGAACAGGGCTCGAATCATCACTTCCAGCCCCCTCTTCAT
CGTCCTCCCCAATTCGAACAGAGCTTGACTGTCTCGGAGCCAGACACCATCGCACTCAACGGTGATGTGGCTGCT
GGCGGTGAGAAGGCCGACAGCAAGCAGTGCCAGGATTGGTTTGCCAAAATGAGGGCCTTTCAGAAATGTGTTGAT
GCGTTCAGAAAGGATCCCGACGAGAAGTGCCCCCGTGTCAAGGTGGCCGTGCTGGACACGGGCGTCGACCTATCG
CACCCTGAAATAGCTGAGGCCCGGGCAGATGAACGCTTGTTGTACCATGATTTTGTCGATTCAGCGGACGGGATC
GGCGACTTGGACGGACATGGAACTCACTGTACCTCCATTCTGCTCAAACATGCCCCCAATGCCCAAGTATATAGC
GGCCGCGTCTTCAGACGCAGCCGGGCAGACAAGGACAGCCCCGTCATCGTGGCCAAGGCTATTTCTCACGCTGCA
GACGTCTGGAAGGTCGACATTATCTCGCTCTCTCTCGGATTTGAGTCTTCTGCTGGCGTCATGCGCGATGCCATC
AGACAAGCCTGTGCCAGAAACATCTTGATCTTCGCAGCAGCGGCCAACAACACGACAAACGAAGTAACGCCCATC
AGATTCCCGGCGAGACTGGACGAGCCCGTCATGGGCTGA
Transcript >Hirsu2|2681
ATGCTCCTTTTGCAGAGCACCTTCTCGTCGACACAACGCGTCGACAGATTCGGCCTCGAGCTGGTTGACTATCTC
GAGGCCCAAGAGCAGCAGACGGCTTACTTGCTCAACGCAATCTTGCGTGACGAGGAGGCTCATCTGTTCCGCGAC
CTTGGCGCGCCAGGCATCTTGCGCCAGGTTGCGGTGCAGCTTCTCCAGACGATACGGCCCCAGAATGCTGCCGAG
GTTCTCGCTACCACAGTCGAACGGTTCCAACAGTCGGCAAGCGATCCAGAATGGTTTGACACCCTGATCGTGTTG
CTTGAGTACGTTCCCTGCGCCTGGATAGTGATTGATCTTGCACTCCTGGGCGATCGGCTCGGGGATGCACAGACT
TGGCCCTCCGACTTTCAGCAGTTGTTTGATCGGCTGCGGGCTAAAGGCTCCTCGGCCTTGTTGAAAGTCGCGCTT
CTCAACTGCCGGGACGTCTTGTCCGGCTCCGTGTCGGCCCATGTCGTCTCGGTTCCGGAGATGCCTACTCTGCCC
TCCATGACGCGGGCCTTACAGAGACAGCGGTTGCAGGAACAGGGCTCGAATCATCACTTCCAGCCCCCTCTTCAT
CGTCCTCCCCAATTCGAACAGAGCTTGACTGTCTCGGAGCCAGACACCATCGCACTCAACGGTGATGTGGCTGCT
GGCGGTGAGAAGGCCGACAGCAAGCAGTGCCAGGATTGGTTTGCCAAAATGAGGGCCTTTCAGAAATGTGTTGAT
GCGTTCAGAAAGGATCCCGACGAGAAGTGCCCCCGTGTCAAGGTGGCCGTGCTGGACACGGGCGTCGACCTATCG
CACCCTGAAATAGCTGAGGCCCGGGCAGATGAACGCTTGTTGTACCATGATTTTGTCGATTCAGCGGACGGGATC
GGCGACTTGGACGGACATGGAACTCACTGTACCTCCATTCTGCTCAAACATGCCCCCAATGCCCAAGTATATAGC
GGCCGCGTCTTCAGACGCAGCCGGGCAGACAAGGACAGCCCCGTCATCGTGGCCAAGGCTATTTCTCACGCTGCA
GACGTCTGGAAGGTCGACATTATCTCGCTCTCTCTCGGATTTGAGTCTTCTGCTGGCGTCATGCGCGATGCCATC
AGACAAGCCTGTGCCAGAAACATCTTGATCTTCGCAGCAGCGGCCAACAACACGACAAACGAAGTAACGCCCATC
AGATTCCCGGCGAGACTGGACGAGCCCGTCATGGGCTGA
Gene >Hirsu2|2681
ATGCTCCTTTTGCAGAGCACCTTCTCGTCGACACAACGCGTCGACAGATTCGGCCTCGAGCTGGTTGACTATCTC
GAGGCCCAAGAGCAGCAGACGGCTTACTTGCTCAACGCAATCTTGCGTGACGAGGAGGCTCATCTGTTCCGCGAC
CTTGGCGCGCCAGGCATCTTGCGCCAGGTTGCGGTGCAGCTTCTCCAGACGATACGGCCCCAGAATGCTGCCGAG
GTTCTCGCTACCACAGTCGAACGGTTCCAACAGTCGGCAAGCGATCCAGAATGGTTTGACACCCTGATCGTGTTG
CTTGAGTACGTTCCCTGCGCCTGGATAGTGATTGATCTTGCACTCCTGGGCGATCGGCTCGGGGATGCACAGACT
TGGCCCTCCGACTTTCAGCAGTTGTTTGATCGGCTGCGGGCTAAAGGCTCCTCGGCCTTGTTGAAAGTCGCGCTT
CTCAACTGCCGGGACGTCTTGTCCGGCTCCGTGTCGGCCCATGTCGTCTCGGTTCCGGAGATGCCTACTCTGCCC
TCCATGACGCGGGCCTTACAGAGACAGCGGTTGCAGGAACAGGGCTCGAATCATCACTTCCAGCCCCCTCTTCAT
CGTCCTCCCCAATTCGAACAGAGCTTGACTGTCTCGGAGCCAGACACCATCGCACTCAACGGTGATGTGGCTGCT
GGCGGTGAGAAGGCCGAGTAAGAGACCGATCCTAGCTGTGCTGCCTTGGCCTTTTTTGGGCTTCCTTCTGACCAG
CTCACCCCATCAGCAGCAAGCAGTGCCAGGATTGGTTTGCCAAAATGAGGGCCTTTCAGAAATGTGTTGATGCGT
TCAGAAAGGATCCCGACGAGAAGTGCCCCCGTGTCAAGGTGGCCGTGCTGGACACGGGCGTCGACCTATCGCACC
CTGAAATAGCTGAGGCCCGGGCAGATGAACGCTTGTTGTACCATGATTTTGTCGATTCAGCGGACGGGATCGGCG
ACTTGGACGGACATGGAACTCACTGTACCTCCATTCTGCTCAAACATGCCCCCAATGCCCAAGTATATAGCGGCC
GCGTCTTCAGACGCAGCCGGGCAGACAAGGACAGCCCCGTCATCGTGGCCAAGGTCAGCCACAGCAGGCGTTCAT
TGAAACTTCGATTCACAGCGGCTGACAGGTTTTGCAGGCTATTTCTCACGCTGCAGACGTCTGGAAGGTCGACAT
TATCTCGCTCTCTCTCGGATTTGAGTCTTCTGCTGGCGTCATGCGCGATGCCATCAGACAAGCCTGTGCCAGAAA
CATCTTGATCTTCGCAGCAGCGGCCAACAACACGACAAACGAAGTAACGCCCATCAGATTCCCGGCGAGACTGGA
CGAGGTAATCTGCGTCTTCGCCTCCGACTCCTTTGGCCGGCCTTCACGGTTCAATCCGCCGCCAGCCCGTCATGG
GCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail