Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2677
Gene name
LocationContig_165:8331..11607
Strand+
Gene length (bp)3276
Transcript length (bp)3276
Coding sequence length (bp)3276
Protein length (aa) 1092

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02194 PXA PXA domain 9.1E-32 171 347
PF08628 Nexin_C Sorting nexin C terminal 5.8E-21 955 1071
PF00787 PX PX domain 2.0E-06 589 678

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0008289 lipid binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005543 phospholipid binding No
GO:0043168 anion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 90 112 22
2 230 252 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2677
MASTSGGDTHPPAPSAGPAPAAEAILANGVLERLDQKRPDGKLAPDPRPPTPSPSAAPPDLTAKGLHFISTATPG
TLAGIAVAFSGVTYAILGRIGLLVIGAVGGVIAFASLEAKHPDIARAVRGEKGPEILDRVWLDLQKDRPRDGDAA
GAPQDSQDDAAALKAFDDFRPETREALGGLVDAVIRDYVKWWYSPIVPTDHSFPLACRKVLNAYLLAVSNRMTRK
RPADAFLDLLTNCSSIIIVFMSELAAAFADLPPDTNMTAADAVYNYLATNPDSRLANLLNQRQQAAKFKLVAEDL
LGFLDQNCQNCDPARVFLREILANSVLETTLQTCSKAEWINGWIVYLLEAGEPDLNQAIDVGMQTGRDTGGNNVF
ADLDGNVGNIGIAKPVRASAEVERSRRKESSSGHKKKLSKADEKLEETGADVGKGRSSRLEEAPHIREPALADAS
LPPFEQGKETLPIRDLGISSKPDLGIADKAPTPITSNSNRSPLRTTPSDEFLSRSEIEYAPITPRSNAAASSQDS
SSPPKAGGQSFTSFDQIVPRPLGGVAEDDPPKKTSPTLHNASFTLHDDATGDNSKIRNKPTWDYLIQVEPASAVH
PGWMIVRRYSDFETLHEILRRIATISGATAFTELHKELPGWRIHTRESLRGELERYLRDACWYLSLAESEGMKRF
LEKSQGHTHGNSKSFGWDTVGKNMLDVLTNGPKGAVEGGKNLVGGVSGVFGNFPGLARKSTNQSVDLTPSSSRLS
ISGHSPVVGAKSPVRSERASIDSQRSSVISTQPGKVPPMDRRMSHQSQIETDVDMGRAGRLDRMDSGSASASARP
SREHSRASSLAPLQSPSMTSIEFMKLPPPPDEIQDDYEASVNSGDASPKTNEGATASHHTRRGSGQSASNLTPLT
PATNGGGGGGGGGGKKAAAAKPGKQYSQLSEQETRVAVELLFAVINEMYTLSSAWNIRRTLLTAAKSFLLRPGNP
SLLTVQSLIQTSVLDANTSDAGIAASLRKLRENSVPTEEERATWPAELTADEKEKLAVKARRLLIQSGMPAALMG
VMGQAATGEALGRVFDCLQIEEVARGLIFGLMLQAVRIVTH*
Coding >Hirsu2|2677
ATGGCTTCCACCTCTGGCGGCGACACGCACCCGCCCGCTCCCTCGGCCGGCCCAGCTCCCGCTGCCGAAGCCATC
TTGGCCAACGGCGTGCTGGAGCGGCTCGACCAGAAGCGACCCGACGGAAAGCTCGCACCCGATCCGAGGCCGCCG
ACGCCGTCCCCCTCTGCTGCCCCTCCCGACCTCACCGCCAAGGGCCTCCACTTCATCTCGACCGCCACGCCCGGC
ACGCTCGCCGGTATCGCCGTCGCCTTCTCCGGCGTCACCTACGCCATCCTCGGACGGATAGGCCTGCTGGTCATC
GGCGCCGTGGGCGGCGTCATCGCCTTCGCCTCGCTCGAGGCCAAACACCCGGACATCGCGCGGGCGGTCCGTGGC
GAAAAGGGCCCCGAGATCTTGGATAGGGTCTGGCTCGATCTGCAGAAAGACCGTCCGCGGGATGGCGACGCCGCT
GGTGCTCCGCAGGATAGCCAGGACGACGCCGCTGCCCTCAAGGCCTTTGACGACTTCCGCCCGGAGACGCGAGAG
GCTCTCGGCGGCCTCGTCGATGCCGTCATCCGAGACTACGTCAAGTGGTGGTATTCGCCCATCGTACCCACCGAC
CACTCCTTTCCTCTCGCCTGCCGCAAGGTGCTCAATGCATACCTGCTCGCCGTCTCCAACCGGATGACCCGGAAG
CGGCCGGCCGATGCCTTCCTCGACCTGTTGACCAACTGCTCCTCCATCATCATCGTCTTCATGTCGGAGCTCGCC
GCCGCCTTCGCCGACTTGCCCCCCGACACCAACATGACGGCCGCCGATGCCGTCTACAACTACCTCGCGACGAAT
CCGGATTCGCGCCTGGCGAACCTCCTGAACCAGAGGCAGCAGGCTGCGAAATTCAAGCTGGTCGCCGAAGACTTG
CTCGGCTTTCTCGACCAGAACTGCCAGAACTGCGATCCCGCACGCGTCTTCCTCCGCGAGATCCTGGCCAACTCG
GTCCTCGAGACGACGCTGCAGACGTGCAGCAAGGCCGAGTGGATCAACGGCTGGATCGTGTATCTGCTGGAGGCT
GGCGAGCCCGACCTCAACCAGGCCATCGACGTCGGCATGCAGACCGGTCGCGATACGGGCGGAAACAATGTCTTC
GCCGACCTGGACGGAAACGTCGGCAACATCGGCATCGCCAAGCCAGTTCGAGCGAGCGCCGAGGTCGAGCGCAGT
CGGCGGAAGGAGTCTTCGTCGGGCCACAAGAAGAAGCTCAGCAAGGCCGACGAAAAACTGGAAGAGACGGGCGCA
GACGTGGGGAAAGGGCGGTCGTCCAGACTGGAAGAAGCGCCGCACATAAGAGAGCCCGCCCTGGCGGATGCCTCG
CTGCCGCCCTTTGAGCAGGGCAAGGAGACCCTGCCGATCAGAGACCTCGGCATCTCCAGCAAACCCGACCTGGGC
ATCGCGGACAAGGCCCCAACACCGATCACGTCCAACAGCAACAGGAGCCCGCTCCGGACTACGCCGTCCGACGAG
TTCCTGTCGAGGAGCGAAATCGAGTACGCACCCATCACGCCACGGTCGAACGCGGCTGCATCCAGCCAGGACTCT
TCCTCCCCGCCCAAGGCTGGTGGACAGTCGTTTACCAGCTTCGACCAGATCGTTCCCCGGCCCCTGGGCGGCGTG
GCGGAAGACGACCCGCCCAAGAAGACGTCGCCCACCCTCCACAACGCCTCCTTCACCCTTCACGACGACGCGACC
GGCGACAACAGCAAGATACGCAACAAGCCCACCTGGGACTACCTGATCCAGGTAGAGCCGGCGTCGGCGGTGCAT
CCCGGATGGATGATCGTCAGGAGGTACTCCGACTTCGAGACGCTGCACGAGATTTTGCGGCGCATCGCGACCATC
TCGGGCGCCACCGCCTTCACGGAGCTGCACAAGGAGCTCCCTGGCTGGCGGATCCACACCAGGGAGTCGCTCCGC
GGCGAGCTGGAGAGGTACCTGCGGGACGCGTGCTGGTATCTGTCGCTGGCCGAGAGCGAGGGCATGAAGCGATTC
CTGGAGAAGAGCCAGGGGCACACCCATGGCAACTCCAAGTCGTTTGGCTGGGACACCGTCGGCAAGAACATGCTG
GACGTGCTCACCAACGGGCCCAAGGGGGCCGTCGAGGGCGGCAAGAACCTGGTGGGCGGCGTCAGCGGCGTCTTT
GGCAATTTCCCCGGGCTGGCCCGCAAGTCGACAAACCAGTCGGTCGATCTGACGCCGAGCTCCAGCCGGCTGTCC
ATATCCGGCCACTCGCCCGTCGTCGGCGCCAAGTCTCCGGTCCGGTCGGAGCGTGCCAGCATAGACAGCCAGCGC
TCGTCCGTCATCTCCACCCAGCCCGGCAAGGTGCCGCCGATGGACAGACGGATGAGCCATCAGTCGCAGATCGAG
ACGGACGTCGACATGGGCCGGGCCGGCCGCCTGGACCGGATGGATTCCGGCTCGGCCTCGGCCAGCGCGCGCCCC
AGCAGGGAGCACAGCCGAGCGTCCAGCCTGGCCCCGCTGCAGTCGCCGTCGATGACGAGCATAGAGTTCATGAAG
TTGCCGCCGCCGCCCGACGAGATACAAGACGACTACGAGGCGTCGGTCAACAGCGGGGACGCGAGCCCCAAGACC
AACGAGGGTGCGACGGCCAGCCACCACACCCGCCGAGGCAGCGGGCAGAGCGCGAGCAACCTCACGCCTCTCACG
CCGGCCACCAACGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAAAAAGGCGGCGGCGGCCAAGCCCGGCAAGCAA
TACTCGCAACTGTCGGAACAGGAAACGCGGGTGGCGGTAGAGCTGCTGTTCGCCGTCATCAACGAAATGTACACG
CTCTCGTCGGCCTGGAACATCCGCCGGACGCTCCTGACGGCCGCCAAGTCGTTTCTCCTGCGCCCGGGGAACCCG
TCGCTGCTGACGGTGCAGTCGCTCATCCAGACGTCGGTGCTCGACGCCAACACGTCGGACGCGGGCATCGCGGCC
TCGCTACGCAAGCTGCGGGAGAACAGCGTGCCGACGGAGGAGGAGCGGGCGACGTGGCCGGCCGAGCTGACGGCC
GACGAGAAGGAGAAGCTGGCGGTCAAGGCGCGGCGGCTGCTGATCCAGAGCGGGATGCCGGCGGCCCTGATGGGG
GTCATGGGCCAGGCGGCGACGGGCGAGGCGCTCGGCAGGGTCTTCGACTGCCTCCAGATCGAGGAGGTCGCCCGC
GGCCTGATCTTCGGGCTCATGCTGCAGGCAGTACGGATCGTGACGCACTGA
Transcript >Hirsu2|2677
ATGGCTTCCACCTCTGGCGGCGACACGCACCCGCCCGCTCCCTCGGCCGGCCCAGCTCCCGCTGCCGAAGCCATC
TTGGCCAACGGCGTGCTGGAGCGGCTCGACCAGAAGCGACCCGACGGAAAGCTCGCACCCGATCCGAGGCCGCCG
ACGCCGTCCCCCTCTGCTGCCCCTCCCGACCTCACCGCCAAGGGCCTCCACTTCATCTCGACCGCCACGCCCGGC
ACGCTCGCCGGTATCGCCGTCGCCTTCTCCGGCGTCACCTACGCCATCCTCGGACGGATAGGCCTGCTGGTCATC
GGCGCCGTGGGCGGCGTCATCGCCTTCGCCTCGCTCGAGGCCAAACACCCGGACATCGCGCGGGCGGTCCGTGGC
GAAAAGGGCCCCGAGATCTTGGATAGGGTCTGGCTCGATCTGCAGAAAGACCGTCCGCGGGATGGCGACGCCGCT
GGTGCTCCGCAGGATAGCCAGGACGACGCCGCTGCCCTCAAGGCCTTTGACGACTTCCGCCCGGAGACGCGAGAG
GCTCTCGGCGGCCTCGTCGATGCCGTCATCCGAGACTACGTCAAGTGGTGGTATTCGCCCATCGTACCCACCGAC
CACTCCTTTCCTCTCGCCTGCCGCAAGGTGCTCAATGCATACCTGCTCGCCGTCTCCAACCGGATGACCCGGAAG
CGGCCGGCCGATGCCTTCCTCGACCTGTTGACCAACTGCTCCTCCATCATCATCGTCTTCATGTCGGAGCTCGCC
GCCGCCTTCGCCGACTTGCCCCCCGACACCAACATGACGGCCGCCGATGCCGTCTACAACTACCTCGCGACGAAT
CCGGATTCGCGCCTGGCGAACCTCCTGAACCAGAGGCAGCAGGCTGCGAAATTCAAGCTGGTCGCCGAAGACTTG
CTCGGCTTTCTCGACCAGAACTGCCAGAACTGCGATCCCGCACGCGTCTTCCTCCGCGAGATCCTGGCCAACTCG
GTCCTCGAGACGACGCTGCAGACGTGCAGCAAGGCCGAGTGGATCAACGGCTGGATCGTGTATCTGCTGGAGGCT
GGCGAGCCCGACCTCAACCAGGCCATCGACGTCGGCATGCAGACCGGTCGCGATACGGGCGGAAACAATGTCTTC
GCCGACCTGGACGGAAACGTCGGCAACATCGGCATCGCCAAGCCAGTTCGAGCGAGCGCCGAGGTCGAGCGCAGT
CGGCGGAAGGAGTCTTCGTCGGGCCACAAGAAGAAGCTCAGCAAGGCCGACGAAAAACTGGAAGAGACGGGCGCA
GACGTGGGGAAAGGGCGGTCGTCCAGACTGGAAGAAGCGCCGCACATAAGAGAGCCCGCCCTGGCGGATGCCTCG
CTGCCGCCCTTTGAGCAGGGCAAGGAGACCCTGCCGATCAGAGACCTCGGCATCTCCAGCAAACCCGACCTGGGC
ATCGCGGACAAGGCCCCAACACCGATCACGTCCAACAGCAACAGGAGCCCGCTCCGGACTACGCCGTCCGACGAG
TTCCTGTCGAGGAGCGAAATCGAGTACGCACCCATCACGCCACGGTCGAACGCGGCTGCATCCAGCCAGGACTCT
TCCTCCCCGCCCAAGGCTGGTGGACAGTCGTTTACCAGCTTCGACCAGATCGTTCCCCGGCCCCTGGGCGGCGTG
GCGGAAGACGACCCGCCCAAGAAGACGTCGCCCACCCTCCACAACGCCTCCTTCACCCTTCACGACGACGCGACC
GGCGACAACAGCAAGATACGCAACAAGCCCACCTGGGACTACCTGATCCAGGTAGAGCCGGCGTCGGCGGTGCAT
CCCGGATGGATGATCGTCAGGAGGTACTCCGACTTCGAGACGCTGCACGAGATTTTGCGGCGCATCGCGACCATC
TCGGGCGCCACCGCCTTCACGGAGCTGCACAAGGAGCTCCCTGGCTGGCGGATCCACACCAGGGAGTCGCTCCGC
GGCGAGCTGGAGAGGTACCTGCGGGACGCGTGCTGGTATCTGTCGCTGGCCGAGAGCGAGGGCATGAAGCGATTC
CTGGAGAAGAGCCAGGGGCACACCCATGGCAACTCCAAGTCGTTTGGCTGGGACACCGTCGGCAAGAACATGCTG
GACGTGCTCACCAACGGGCCCAAGGGGGCCGTCGAGGGCGGCAAGAACCTGGTGGGCGGCGTCAGCGGCGTCTTT
GGCAATTTCCCCGGGCTGGCCCGCAAGTCGACAAACCAGTCGGTCGATCTGACGCCGAGCTCCAGCCGGCTGTCC
ATATCCGGCCACTCGCCCGTCGTCGGCGCCAAGTCTCCGGTCCGGTCGGAGCGTGCCAGCATAGACAGCCAGCGC
TCGTCCGTCATCTCCACCCAGCCCGGCAAGGTGCCGCCGATGGACAGACGGATGAGCCATCAGTCGCAGATCGAG
ACGGACGTCGACATGGGCCGGGCCGGCCGCCTGGACCGGATGGATTCCGGCTCGGCCTCGGCCAGCGCGCGCCCC
AGCAGGGAGCACAGCCGAGCGTCCAGCCTGGCCCCGCTGCAGTCGCCGTCGATGACGAGCATAGAGTTCATGAAG
TTGCCGCCGCCGCCCGACGAGATACAAGACGACTACGAGGCGTCGGTCAACAGCGGGGACGCGAGCCCCAAGACC
AACGAGGGTGCGACGGCCAGCCACCACACCCGCCGAGGCAGCGGGCAGAGCGCGAGCAACCTCACGCCTCTCACG
CCGGCCACCAACGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAAAAAGGCGGCGGCGGCCAAGCCCGGCAAGCAA
TACTCGCAACTGTCGGAACAGGAAACGCGGGTGGCGGTAGAGCTGCTGTTCGCCGTCATCAACGAAATGTACACG
CTCTCGTCGGCCTGGAACATCCGCCGGACGCTCCTGACGGCCGCCAAGTCGTTTCTCCTGCGCCCGGGGAACCCG
TCGCTGCTGACGGTGCAGTCGCTCATCCAGACGTCGGTGCTCGACGCCAACACGTCGGACGCGGGCATCGCGGCC
TCGCTACGCAAGCTGCGGGAGAACAGCGTGCCGACGGAGGAGGAGCGGGCGACGTGGCCGGCCGAGCTGACGGCC
GACGAGAAGGAGAAGCTGGCGGTCAAGGCGCGGCGGCTGCTGATCCAGAGCGGGATGCCGGCGGCCCTGATGGGG
GTCATGGGCCAGGCGGCGACGGGCGAGGCGCTCGGCAGGGTCTTCGACTGCCTCCAGATCGAGGAGGTCGCCCGC
GGCCTGATCTTCGGGCTCATGCTGCAGGCAGTACGGATCGTGACGCACTGA
Gene >Hirsu2|2677
ATGGCTTCCACCTCTGGCGGCGACACGCACCCGCCCGCTCCCTCGGCCGGCCCAGCTCCCGCTGCCGAAGCCATC
TTGGCCAACGGCGTGCTGGAGCGGCTCGACCAGAAGCGACCCGACGGAAAGCTCGCACCCGATCCGAGGCCGCCG
ACGCCGTCCCCCTCTGCTGCCCCTCCCGACCTCACCGCCAAGGGCCTCCACTTCATCTCGACCGCCACGCCCGGC
ACGCTCGCCGGTATCGCCGTCGCCTTCTCCGGCGTCACCTACGCCATCCTCGGACGGATAGGCCTGCTGGTCATC
GGCGCCGTGGGCGGCGTCATCGCCTTCGCCTCGCTCGAGGCCAAACACCCGGACATCGCGCGGGCGGTCCGTGGC
GAAAAGGGCCCCGAGATCTTGGATAGGGTCTGGCTCGATCTGCAGAAAGACCGTCCGCGGGATGGCGACGCCGCT
GGTGCTCCGCAGGATAGCCAGGACGACGCCGCTGCCCTCAAGGCCTTTGACGACTTCCGCCCGGAGACGCGAGAG
GCTCTCGGCGGCCTCGTCGATGCCGTCATCCGAGACTACGTCAAGTGGTGGTATTCGCCCATCGTACCCACCGAC
CACTCCTTTCCTCTCGCCTGCCGCAAGGTGCTCAATGCATACCTGCTCGCCGTCTCCAACCGGATGACCCGGAAG
CGGCCGGCCGATGCCTTCCTCGACCTGTTGACCAACTGCTCCTCCATCATCATCGTCTTCATGTCGGAGCTCGCC
GCCGCCTTCGCCGACTTGCCCCCCGACACCAACATGACGGCCGCCGATGCCGTCTACAACTACCTCGCGACGAAT
CCGGATTCGCGCCTGGCGAACCTCCTGAACCAGAGGCAGCAGGCTGCGAAATTCAAGCTGGTCGCCGAAGACTTG
CTCGGCTTTCTCGACCAGAACTGCCAGAACTGCGATCCCGCACGCGTCTTCCTCCGCGAGATCCTGGCCAACTCG
GTCCTCGAGACGACGCTGCAGACGTGCAGCAAGGCCGAGTGGATCAACGGCTGGATCGTGTATCTGCTGGAGGCT
GGCGAGCCCGACCTCAACCAGGCCATCGACGTCGGCATGCAGACCGGTCGCGATACGGGCGGAAACAATGTCTTC
GCCGACCTGGACGGAAACGTCGGCAACATCGGCATCGCCAAGCCAGTTCGAGCGAGCGCCGAGGTCGAGCGCAGT
CGGCGGAAGGAGTCTTCGTCGGGCCACAAGAAGAAGCTCAGCAAGGCCGACGAAAAACTGGAAGAGACGGGCGCA
GACGTGGGGAAAGGGCGGTCGTCCAGACTGGAAGAAGCGCCGCACATAAGAGAGCCCGCCCTGGCGGATGCCTCG
CTGCCGCCCTTTGAGCAGGGCAAGGAGACCCTGCCGATCAGAGACCTCGGCATCTCCAGCAAACCCGACCTGGGC
ATCGCGGACAAGGCCCCAACACCGATCACGTCCAACAGCAACAGGAGCCCGCTCCGGACTACGCCGTCCGACGAG
TTCCTGTCGAGGAGCGAAATCGAGTACGCACCCATCACGCCACGGTCGAACGCGGCTGCATCCAGCCAGGACTCT
TCCTCCCCGCCCAAGGCTGGTGGACAGTCGTTTACCAGCTTCGACCAGATCGTTCCCCGGCCCCTGGGCGGCGTG
GCGGAAGACGACCCGCCCAAGAAGACGTCGCCCACCCTCCACAACGCCTCCTTCACCCTTCACGACGACGCGACC
GGCGACAACAGCAAGATACGCAACAAGCCCACCTGGGACTACCTGATCCAGGTAGAGCCGGCGTCGGCGGTGCAT
CCCGGATGGATGATCGTCAGGAGGTACTCCGACTTCGAGACGCTGCACGAGATTTTGCGGCGCATCGCGACCATC
TCGGGCGCCACCGCCTTCACGGAGCTGCACAAGGAGCTCCCTGGCTGGCGGATCCACACCAGGGAGTCGCTCCGC
GGCGAGCTGGAGAGGTACCTGCGGGACGCGTGCTGGTATCTGTCGCTGGCCGAGAGCGAGGGCATGAAGCGATTC
CTGGAGAAGAGCCAGGGGCACACCCATGGCAACTCCAAGTCGTTTGGCTGGGACACCGTCGGCAAGAACATGCTG
GACGTGCTCACCAACGGGCCCAAGGGGGCCGTCGAGGGCGGCAAGAACCTGGTGGGCGGCGTCAGCGGCGTCTTT
GGCAATTTCCCCGGGCTGGCCCGCAAGTCGACAAACCAGTCGGTCGATCTGACGCCGAGCTCCAGCCGGCTGTCC
ATATCCGGCCACTCGCCCGTCGTCGGCGCCAAGTCTCCGGTCCGGTCGGAGCGTGCCAGCATAGACAGCCAGCGC
TCGTCCGTCATCTCCACCCAGCCCGGCAAGGTGCCGCCGATGGACAGACGGATGAGCCATCAGTCGCAGATCGAG
ACGGACGTCGACATGGGCCGGGCCGGCCGCCTGGACCGGATGGATTCCGGCTCGGCCTCGGCCAGCGCGCGCCCC
AGCAGGGAGCACAGCCGAGCGTCCAGCCTGGCCCCGCTGCAGTCGCCGTCGATGACGAGCATAGAGTTCATGAAG
TTGCCGCCGCCGCCCGACGAGATACAAGACGACTACGAGGCGTCGGTCAACAGCGGGGACGCGAGCCCCAAGACC
AACGAGGGTGCGACGGCCAGCCACCACACCCGCCGAGGCAGCGGGCAGAGCGCGAGCAACCTCACGCCTCTCACG
CCGGCCACCAACGGCGGCGGCGGCGGCGGCGGCGGCGGCGGCAAAAAGGCGGCGGCGGCCAAGCCCGGCAAGCAA
TACTCGCAACTGTCGGAACAGGAAACGCGGGTGGCGGTAGAGCTGCTGTTCGCCGTCATCAACGAAATGTACACG
CTCTCGTCGGCCTGGAACATCCGCCGGACGCTCCTGACGGCCGCCAAGTCGTTTCTCCTGCGCCCGGGGAACCCG
TCGCTGCTGACGGTGCAGTCGCTCATCCAGACGTCGGTGCTCGACGCCAACACGTCGGACGCGGGCATCGCGGCC
TCGCTACGCAAGCTGCGGGAGAACAGCGTGCCGACGGAGGAGGAGCGGGCGACGTGGCCGGCCGAGCTGACGGCC
GACGAGAAGGAGAAGCTGGCGGTCAAGGCGCGGCGGCTGCTGATCCAGAGCGGGATGCCGGCGGCCCTGATGGGG
GTCATGGGCCAGGCGGCGACGGGCGAGGCGCTCGGCAGGGTCTTCGACTGCCTCCAGATCGAGGAGGTCGCCCGC
GGCCTGATCTTCGGGCTCATGCTGCAGGCAGTACGGATCGTGACGCACTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail