Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2675
Gene name
LocationContig_165:3559..5561
Strand-
Gene length (bp)2002
Transcript length (bp)1779
Coding sequence length (bp)1779
Protein length (aa) 593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-26 134 550
PF00083 Sugar_tr Sugar (and other) transporter 5.1E-12 149 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 93 588 8.0E-99
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 99 588 1.0E-42
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 99 588 1.0E-42
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 99 588 5.0E-42
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 99 588 4.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C101|YKT8_SCHPO Uncharacterized MFS-type transporter PB1E7.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1E7.08c PE=1 SV=1 93 588 8.0E-99
sp|Q8N4V2|SVOP_HUMAN Synaptic vesicle 2-related protein OS=Homo sapiens GN=SVOP PE=2 SV=1 99 588 1.0E-42
sp|Q5R5T8|SVOP_PONAB Synaptic vesicle 2-related protein OS=Pongo abelii GN=SVOP PE=2 SV=1 99 588 1.0E-42
sp|Q1JP63|SVOP_BOVIN Synaptic vesicle 2-related protein OS=Bos taurus GN=SVOP PE=2 SV=1 99 588 5.0E-42
sp|Q2XWK0|SVOP_XENLA Synaptic vesicle 2-related protein OS=Xenopus laevis GN=svop PE=2 SV=1 99 588 4.0E-40
sp|Q8BFT9|SVOP_MOUSE Synaptic vesicle 2-related protein OS=Mus musculus GN=Svop PE=1 SV=1 99 588 7.0E-40
sp|Q9Z2I7|SVOP_RAT Synaptic vesicle 2-related protein OS=Rattus norvegicus GN=Svop PE=1 SV=1 99 588 4.0E-39
sp|P30638|SVOP_CAEEL Putative transporter svop-1 OS=Caenorhabditis elegans GN=svop-1 PE=3 SV=5 57 592 9.0E-35
sp|Q940M4|OCT7_ARATH Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana GN=OCT7 PE=2 SV=1 100 588 9.0E-34
sp|Q8BG39|SV2B_MOUSE Synaptic vesicle glycoprotein 2B OS=Mus musculus GN=Sv2b PE=1 SV=1 56 322 5.0E-18
sp|Q63564|SV2B_RAT Synaptic vesicle glycoprotein 2B OS=Rattus norvegicus GN=Sv2b PE=1 SV=1 51 322 3.0E-17
sp|Q7L1I2|SV2B_HUMAN Synaptic vesicle glycoprotein 2B OS=Homo sapiens GN=SV2B PE=1 SV=1 51 322 3.0E-17
sp|Q9Z2I6|SV2C_RAT Synaptic vesicle glycoprotein 2C OS=Rattus norvegicus GN=Sv2c PE=1 SV=1 51 322 3.0E-17
sp|Q69ZS6|SV2C_MOUSE Synaptic vesicle glycoprotein 2C OS=Mus musculus GN=Sv2c PE=1 SV=2 51 322 8.0E-17
sp|Q496J9|SV2C_HUMAN Synaptic vesicle glycoprotein 2C OS=Homo sapiens GN=SV2C PE=1 SV=1 51 322 1.0E-16
sp|Q4R4X3|SV2A_MACFA Synaptic vesicle glycoprotein 2A OS=Macaca fascicularis GN=SV2A PE=2 SV=1 51 346 2.0E-16
sp|Q7L0J3|SV2A_HUMAN Synaptic vesicle glycoprotein 2A OS=Homo sapiens GN=SV2A PE=1 SV=1 51 346 2.0E-16
sp|Q29397|SV2A_BOVIN Synaptic vesicle glycoprotein 2A OS=Bos taurus GN=SV2A PE=2 SV=1 51 346 4.0E-16
sp|Q02563|SV2A_RAT Synaptic vesicle glycoprotein 2A OS=Rattus norvegicus GN=Sv2a PE=1 SV=2 51 346 5.0E-16
sp|Q9JIS5|SV2A_MOUSE Synaptic vesicle glycoprotein 2A OS=Mus musculus GN=Sv2a PE=1 SV=1 51 346 5.0E-16
sp|Q5R4L9|SV2A_PONAB Synaptic vesicle glycoprotein 2A OS=Pongo abelii GN=SV2A PE=2 SV=1 51 346 1.0E-15
sp|Q9H015|S22A4_HUMAN Solute carrier family 22 member 4 OS=Homo sapiens GN=SLC22A4 PE=1 SV=3 152 550 1.0E-14
sp|A7MBE0|S22A1_BOVIN Solute carrier family 22 member 1 OS=Bos taurus GN=SLC22A1 PE=2 SV=1 140 589 1.0E-14
sp|Q9R141|S22A4_RAT Solute carrier family 22 member 4 OS=Rattus norvegicus GN=Slc22a4 PE=1 SV=1 155 550 2.0E-14
sp|Q9VCA2|ORCT_DROME Organic cation transporter protein OS=Drosophila melanogaster GN=Orct PE=1 SV=1 155 552 2.0E-14
sp|O77504|S22A1_RABIT Solute carrier family 22 member 1 OS=Oryctolagus cuniculus GN=SLC22A1 PE=1 SV=1 120 589 2.0E-14
sp|A9CB25|S22A4_PAPAN Solute carrier family 22 member 4 OS=Papio anubis GN=SLC22A4 PE=3 SV=1 152 550 2.0E-14
sp|Q9Z306|S22A4_MOUSE Solute carrier family 22 member 4 OS=Mus musculus GN=Slc22a4 PE=1 SV=1 155 550 4.0E-14
sp|Q9Z0E8|S22A5_MOUSE Solute carrier family 22 member 5 OS=Mus musculus GN=Slc22a5 PE=1 SV=1 155 579 4.0E-14
sp|Q9WTN6|S22AL_MOUSE Solute carrier family 22 member 21 OS=Mus musculus GN=Slc22a21 PE=2 SV=1 155 579 1.0E-13
sp|O15245|S22A1_HUMAN Solute carrier family 22 member 1 OS=Homo sapiens GN=SLC22A1 PE=1 SV=2 157 589 2.0E-13
sp|Q9Y226|S22AD_HUMAN Solute carrier family 22 member 13 OS=Homo sapiens GN=SLC22A13 PE=2 SV=2 101 588 6.0E-13
sp|O70594|S22A5_RAT Solute carrier family 22 member 5 OS=Rattus norvegicus GN=Slc22a5 PE=1 SV=1 155 579 6.0E-13
sp|Q6PDF3|SVOPL_MOUSE Putative transporter SVOPL OS=Mus musculus GN=Svopl PE=2 SV=1 92 588 7.0E-12
sp|Q86VW1|S22AG_HUMAN Solute carrier family 22 member 16 OS=Homo sapiens GN=SLC22A16 PE=1 SV=1 162 550 5.0E-11
sp|P37514|YYAJ_BACSU Putative metabolite transport protein YyaJ OS=Bacillus subtilis (strain 168) GN=yyaJ PE=3 SV=2 113 552 6.0E-11
sp|Q63089|S22A1_RAT Solute carrier family 22 member 1 OS=Rattus norvegicus GN=Slc22a1 PE=1 SV=1 157 589 7.0E-11
sp|O08966|S22A1_MOUSE Solute carrier family 22 member 1 OS=Mus musculus GN=Slc22a1 PE=1 SV=2 157 589 6.0E-10
sp|O34691|NAIP_BACSU Putative niacin/nicotinamide transporter NaiP OS=Bacillus subtilis (strain 168) GN=naiP PE=1 SV=1 115 265 7.0E-10
sp|Q9U539|OCT1_CAEEL Organic cation transporter 1 OS=Caenorhabditis elegans GN=oct-1 PE=1 SV=3 89 553 2.0E-09
sp|Q8N434|SVOPL_HUMAN Putative transporter SVOPL OS=Homo sapiens GN=SVOPL PE=2 SV=2 94 588 2.0E-09
sp|Q6A4L0|S22AD_MOUSE Solute carrier family 22 member 13 OS=Mus musculus GN=Slc22a13 PE=1 SV=3 140 588 2.0E-08
sp|O15244|S22A2_HUMAN Solute carrier family 22 member 2 OS=Homo sapiens GN=SLC22A2 PE=1 SV=2 157 567 2.0E-08
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 104 312 4.0E-08
sp|Q80UJ1|S22AK_MOUSE Solute carrier family 22 member 20 OS=Mus musculus GN=Slc22a20 PE=1 SV=1 120 588 1.0E-07
sp|Q1LVS8|SVOPL_DANRE Putative transporter SVOPL OS=Danio rerio GN=svopl PE=2 SV=1 469 588 2.0E-07
sp|A6NK97|S22AK_HUMAN Solute carrier family 22 member 20 OS=Homo sapiens GN=SLC22A20 PE=2 SV=1 150 588 1.0E-06
sp|P31679|YAAU_ECOLI Putative metabolite transport protein YaaU OS=Escherichia coli (strain K12) GN=yaaU PE=3 SV=2 101 311 1.0E-06
sp|Q51955|PCAK_PSEPU 4-hydroxybenzoate transporter PcaK OS=Pseudomonas putida GN=pcaK PE=1 SV=1 96 241 1.0E-06
sp|Q9I6Q3|PCAK_PSEAE 4-hydroxybenzoate transporter PcaK OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pcaK PE=3 SV=1 109 241 3.0E-06
sp|Q6DFR1|S22AF_XENTR Solute carrier family 22 member 15 OS=Xenopus tropicalis GN=slc22a15 PE=2 SV=2 152 554 4.0E-06
sp|Q17QN9|S22AG_BOVIN Solute carrier family 22 member 16 OS=Bos taurus GN=SLC22A16 PE=2 SV=2 297 551 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 112 134 22
2 154 176 22
3 183 205 22
4 210 232 22
5 239 261 22
6 271 293 22
7 387 409 22
8 441 463 22
9 476 498 22
10 562 584 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2675
MKVWWRLGLGRVESVDDYEGVLVPLHEAHLHSYSARTRSTVQLLAPEKTVDDDDDDDDTEKQGMLAEDGGAGYSI
DGLRREMREGRRGRWTEYEIKSKLINKAIQDIGMGPYNWRLFVLCGFGWFADNLWLQGVSLCLPSLSAEFGLSEK
TVRYTTSALFVGLSAGSFTWGIGSDLMGRRIAFNATLLITSAFGLAAACAPTWAGVCLLFAGAGFGVGGNLPVDG
ALFLEFLPDASSALLTLLSVWWPVGQLASSLAAWWLIAGWPVDQGWRLFVAAIGLLTFAMFVVRFFYFHLFESPK
FLLNRGRQAEAVAVVHGIAHRNGAKTWLTSDILDLVAVVAASADDEDRNRPVAPVVAAASGSGLLRDKVRGFVSP
DRLRPLFRSRELGLATGLVWFCWASIGMGYPLFNAFLPQYLARHGGGGGGGGVAASSDTAPISGETYRNYAIASV
LGVPGSLLAAWLVDRPSPLLGRRGTLAGSTLVSALFLFLFAALGTTPGAQLAFSCVEAFAQNIMYGVLYAFTPEL
FPAPVRGAGTGVASFLNRLTGLLAPVIAATMPGDGATAPISVSAVLILAAFVGMCLIPIETRGAQRL*
Coding >Hirsu2|2675
ATGAAGGTCTGGTGGCGCCTGGGCCTAGGCCGCGTCGAGTCGGTGGACGACTACGAGGGCGTCCTCGTCCCGCTA
CACGAGGCGCATCTGCACAGCTACTCGGCGCGGACGCGCAGCACGGTGCAGCTCTTGGCTCCCGAGAAGACGGTC
GACGATGATGACGACGACGATGACACGGAGAAGCAGGGCATGCTGGCCGAGGACGGCGGCGCCGGGTACAGCATT
GACGGCCTGCGCAGGGAGATGAGGGAGGGCCGGCGCGGCCGCTGGACCGAGTACGAGATCAAGTCCAAGCTCATC
AACAAGGCCATCCAGGACATCGGCATGGGGCCCTACAACTGGCGCCTGTTCGTCCTGTGCGGCTTCGGCTGGTTC
GCCGATAACCTATGGTTGCAGGGCGTCTCGCTGTGTCTGCCGTCGCTGTCGGCCGAGTTCGGGCTGTCGGAGAAG
ACGGTGCGGTACACGACGAGCGCGCTGTTCGTCGGCCTGTCGGCCGGCAGCTTCACCTGGGGCATCGGGTCGGAC
CTGATGGGGCGGCGGATCGCGTTCAACGCGACGCTGCTCATCACCAGCGCCTTCGGGCTGGCGGCCGCCTGCGCG
CCGACCTGGGCCGGCGTCTGCCTCCTCTTCGCCGGCGCCGGCTTCGGCGTCGGCGGCAACCTGCCCGTCGACGGC
GCCCTGTTCCTCGAGTTCCTGCCGGACGCGTCGAGCGCGCTGCTGACGCTGCTGTCGGTCTGGTGGCCCGTCGGC
CAGCTGGCCTCGTCGCTGGCCGCCTGGTGGCTCATCGCCGGCTGGCCAGTCGACCAGGGCTGGCGCCTCTTCGTC
GCCGCCATCGGCCTGCTGACCTTTGCCATGTTCGTCGTCCGCTTCTTCTACTTCCACCTCTTCGAGTCGCCCAAG
TTCCTGCTCAACCGCGGCCGCCAGGCCGAGGCCGTCGCCGTCGTCCACGGCATCGCCCACCGCAACGGCGCCAAG
ACCTGGCTCACGTCCGACATCCTCGACCTGGTCGCCGTCGTCGCCGCCTCCGCCGACGACGAGGACCGCAACCGC
CCCGTCGCCCCCGTCGTCGCCGCCGCCTCCGGCTCCGGCCTGCTCCGCGACAAGGTCCGCGGCTTCGTCTCGCCC
GACCGGCTCCGCCCGCTGTTCCGCTCGCGCGAGCTCGGCCTCGCCACCGGCCTCGTCTGGTTCTGCTGGGCCAGC
ATCGGCATGGGCTACCCCCTGTTCAACGCCTTCCTGCCGCAGTACTTGGCCCGCCACGGCGGCGGCGGCGGCGGC
GGCGGCGTGGCGGCGTCGTCGGACACGGCCCCGATCTCGGGCGAGACGTACCGCAACTACGCCATCGCGTCCGTG
CTCGGCGTCCCCGGCAGCCTGCTGGCCGCTTGGCTGGTGGACCGGCCGTCGCCGCTGCTCGGGCGGCGCGGCACC
CTGGCCGGCTCCACGCTCGTCTCGGCCCTCTTCCTCTTCCTCTTCGCCGCGCTCGGCACCACGCCCGGCGCCCAG
CTGGCCTTTTCCTGCGTCGAGGCCTTCGCCCAGAACATCATGTACGGCGTCCTCTACGCCTTCACCCCGGAGCTC
TTCCCCGCGCCCGTCCGCGGCGCCGGCACCGGCGTCGCCAGCTTCCTCAACCGCCTGACGGGGCTGCTGGCCCCC
GTCATCGCCGCCACCATGCCCGGCGACGGCGCTACCGCGCCCATCTCCGTCTCCGCCGTCCTCATCCTCGCCGCC
TTCGTCGGCATGTGCCTCATCCCTATCGAGACGCGCGGCGCCCAGCGGCTGTGA
Transcript >Hirsu2|2675
ATGAAGGTCTGGTGGCGCCTGGGCCTAGGCCGCGTCGAGTCGGTGGACGACTACGAGGGCGTCCTCGTCCCGCTA
CACGAGGCGCATCTGCACAGCTACTCGGCGCGGACGCGCAGCACGGTGCAGCTCTTGGCTCCCGAGAAGACGGTC
GACGATGATGACGACGACGATGACACGGAGAAGCAGGGCATGCTGGCCGAGGACGGCGGCGCCGGGTACAGCATT
GACGGCCTGCGCAGGGAGATGAGGGAGGGCCGGCGCGGCCGCTGGACCGAGTACGAGATCAAGTCCAAGCTCATC
AACAAGGCCATCCAGGACATCGGCATGGGGCCCTACAACTGGCGCCTGTTCGTCCTGTGCGGCTTCGGCTGGTTC
GCCGATAACCTATGGTTGCAGGGCGTCTCGCTGTGTCTGCCGTCGCTGTCGGCCGAGTTCGGGCTGTCGGAGAAG
ACGGTGCGGTACACGACGAGCGCGCTGTTCGTCGGCCTGTCGGCCGGCAGCTTCACCTGGGGCATCGGGTCGGAC
CTGATGGGGCGGCGGATCGCGTTCAACGCGACGCTGCTCATCACCAGCGCCTTCGGGCTGGCGGCCGCCTGCGCG
CCGACCTGGGCCGGCGTCTGCCTCCTCTTCGCCGGCGCCGGCTTCGGCGTCGGCGGCAACCTGCCCGTCGACGGC
GCCCTGTTCCTCGAGTTCCTGCCGGACGCGTCGAGCGCGCTGCTGACGCTGCTGTCGGTCTGGTGGCCCGTCGGC
CAGCTGGCCTCGTCGCTGGCCGCCTGGTGGCTCATCGCCGGCTGGCCAGTCGACCAGGGCTGGCGCCTCTTCGTC
GCCGCCATCGGCCTGCTGACCTTTGCCATGTTCGTCGTCCGCTTCTTCTACTTCCACCTCTTCGAGTCGCCCAAG
TTCCTGCTCAACCGCGGCCGCCAGGCCGAGGCCGTCGCCGTCGTCCACGGCATCGCCCACCGCAACGGCGCCAAG
ACCTGGCTCACGTCCGACATCCTCGACCTGGTCGCCGTCGTCGCCGCCTCCGCCGACGACGAGGACCGCAACCGC
CCCGTCGCCCCCGTCGTCGCCGCCGCCTCCGGCTCCGGCCTGCTCCGCGACAAGGTCCGCGGCTTCGTCTCGCCC
GACCGGCTCCGCCCGCTGTTCCGCTCGCGCGAGCTCGGCCTCGCCACCGGCCTCGTCTGGTTCTGCTGGGCCAGC
ATCGGCATGGGCTACCCCCTGTTCAACGCCTTCCTGCCGCAGTACTTGGCCCGCCACGGCGGCGGCGGCGGCGGC
GGCGGCGTGGCGGCGTCGTCGGACACGGCCCCGATCTCGGGCGAGACGTACCGCAACTACGCCATCGCGTCCGTG
CTCGGCGTCCCCGGCAGCCTGCTGGCCGCTTGGCTGGTGGACCGGCCGTCGCCGCTGCTCGGGCGGCGCGGCACC
CTGGCCGGCTCCACGCTCGTCTCGGCCCTCTTCCTCTTCCTCTTCGCCGCGCTCGGCACCACGCCCGGCGCCCAG
CTGGCCTTTTCCTGCGTCGAGGCCTTCGCCCAGAACATCATGTACGGCGTCCTCTACGCCTTCACCCCGGAGCTC
TTCCCCGCGCCCGTCCGCGGCGCCGGCACCGGCGTCGCCAGCTTCCTCAACCGCCTGACGGGGCTGCTGGCCCCC
GTCATCGCCGCCACCATGCCCGGCGACGGCGCTACCGCGCCCATCTCCGTCTCCGCCGTCCTCATCCTCGCCGCC
TTCGTCGGCATGTGCCTCATCCCTATCGAGACGCGCGGCGCCCAGCGGCTGTGA
Gene >Hirsu2|2675
ATGAAGGTCTGGTGGCGCCTGGGCCTAGGCCGCGTCGAGTCGGTGGACGACTACGAGGGCGTCCTCGTCCCGCTA
CACGAGGCGCATCTGCACAGCTACTCGGCGCGGACGCGCAGCACGGTGCAGCTCTTGGCTCCCGAGAAGACGGTC
GACGATGATGACGACGACGATGACACGGAGAAGCAGGGCATGCTGGCCGAGGACGGCGGCGCCGGGTACAGCATT
GACGGCCTGCGCAGGGAGATGAGGGAGGGCCGGCGCGGCCGCTGGACCGAGTACGAGAGTAGGTTGTCGTCGGCG
ACCGGCTCGTGTCCCGCTGCTGACGATGCCGCGGCCAGTCAAGTCCAAGCTCATCAACAAGGCCATCCAGGACAT
CGGCATGGGGCCCTACAACTGGCGCCTGTTCGTCCTGTGCGGCTTCGGCTGGTTCGCCGATAAGTGCGTGCCCGA
AAAAAAACCAATCCGTCTCCGTCCTTGCCCACCCGCTGACTCGTCGCTCTCGTCGTCTTCACAGCCTATGGTTGC
AGGTACGCGCAGCACCCCTATGTCCTCCCCGACCGCGGTCACGGCAGGAGAAGGGTGTAGCTTGGCTGACGACGA
GGTGTGTGTTTGGCGACAGGGCGTCTCGCTGTGTCTGCCGTCGCTGTCGGCCGAGTTCGGGCTGTCGGAGAAGAC
GGTGCGGTACACGACGAGCGCGCTGTTCGTCGGCCTGTCGGCCGGCAGCTTCACCTGGGGCATCGGGTCGGACCT
GATGGGGCGGCGGATCGCGTTCAACGCGACGCTGCTCATCACCAGCGCCTTCGGGCTGGCGGCCGCCTGCGCGCC
GACCTGGGCCGGCGTCTGCCTCCTCTTCGCCGGCGCCGGCTTCGGCGTCGGCGGCAACCTGCCCGTCGACGGCGC
CCTGTTCCTCGAGTTCCTGCCGGACGCGTCGAGCGCGCTGCTGACGCTGCTGTCGGTCTGGTGGCCCGTCGGCCA
GCTGGCCTCGTCGCTGGCCGCCTGGTGGCTCATCGCCGGCTGGCCAGTCGACCAGGGCTGGCGCCTCTTCGTCGC
CGCCATCGGCCTGCTGACCTTTGCCATGTTCGTCGTCCGCTTCTTCTACTTCCACCTCTTCGAGTCGCCCAAGTT
CCTGCTCAACCGCGGCCGCCAGGCCGAGGCCGTCGCCGTCGTCCACGGCATCGCCCACCGCAACGGCGCCAAGAC
CTGGCTCACGTCCGACATCCTCGACCTGGTCGCCGTCGTCGCCGCCTCCGCCGACGACGAGGACCGCAACCGCCC
CGTCGCCCCCGTCGTCGCCGCCGCCTCCGGCTCCGGCCTGCTCCGCGACAAGGTCCGCGGCTTCGTCTCGCCCGA
CCGGCTCCGCCCGCTGTTCCGCTCGCGCGAGCTCGGCCTCGCCACCGGCCTCGTCTGGTTCTGCTGGGCCAGCAT
CGGCATGGGCTACCCCCTGTTCAACGCCTTCCTGCCGCAGTACTTGGCCCGCCACGGCGGCGGCGGCGGCGGCGG
CGGCGTGGCGGCGTCGTCGGACACGGCCCCGATCTCGGGCGAGACGTACCGCAACTACGCCATCGCGTCCGTGCT
CGGCGTCCCCGGCAGCCTGCTGGCCGCTTGGCTGGTGGACCGGCCGTCGCCGCTGCTCGGGCGGCGCGGCACCCT
GGCCGGCTCCACGCTCGTCTCGGCCCTCTTCCTCTTCCTCTTCGCCGCGCTCGGCACCACGCCCGGCGCCCAGCT
GGCCTTTTCCTGCGTCGAGGCCTTCGCCCAGAACATCATGTACGGCGTCCTCTACGCCTTCACCCCGGAGCTCTT
CCCCGCGCCCGTCCGCGGCGCCGGCACCGGCGTCGCCAGCTTCCTCAACCGCCTGACGGGGCTGCTGGCCCCCGT
CATCGCCGCCACCATGCCCGGCGACGGCGCTACCGCGCCCATCTCCGTCTCCGCCGTCCTCATCCTCGCCGCCTT
CGTCGGCATGTGCCTCATCCCTATCGAGACGCGCGGCGCCCAGCGGCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail