Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2668
Gene name
LocationContig_1647:56..837
Strand-
Gene length (bp)781
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01571 GCV_T Aminomethyltransferase folate-binding domain 6.3E-46 56 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14110|GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv1 PE=3 SV=1 33 239 1.0E-43
sp|P48015|GCST_YEAST Aminomethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCV1 PE=1 SV=2 52 237 8.0E-34
sp|O65396|GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=GDCST PE=2 SV=1 46 239 1.0E-33
sp|Q3B5U7|GCST_CHLL7 Aminomethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gcvT PE=3 SV=1 52 229 4.0E-32
sp|P25285|GCST_BOVIN Aminomethyltransferase, mitochondrial OS=Bos taurus GN=AMT PE=1 SV=1 20 227 7.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14110|GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv1 PE=3 SV=1 33 239 1.0E-43
sp|P48015|GCST_YEAST Aminomethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCV1 PE=1 SV=2 52 237 8.0E-34
sp|O65396|GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=GDCST PE=2 SV=1 46 239 1.0E-33
sp|Q3B5U7|GCST_CHLL7 Aminomethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gcvT PE=3 SV=1 52 229 4.0E-32
sp|P25285|GCST_BOVIN Aminomethyltransferase, mitochondrial OS=Bos taurus GN=AMT PE=1 SV=1 20 227 7.0E-32
sp|O49849|GCST_FLAAN Aminomethyltransferase, mitochondrial OS=Flaveria anomala GN=GDCST PE=3 SV=1 46 239 9.0E-32
sp|P49364|GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum GN=GDCST PE=1 SV=2 46 239 1.0E-31
sp|P48728|GCST_HUMAN Aminomethyltransferase, mitochondrial OS=Homo sapiens GN=AMT PE=1 SV=1 45 227 4.0E-31
sp|Q8CFA2|GCST_MOUSE Aminomethyltransferase, mitochondrial OS=Mus musculus GN=Amt PE=1 SV=1 14 227 5.0E-31
sp|P49363|GCST_FLAPR Aminomethyltransferase, mitochondrial OS=Flaveria pringlei GN=GDCST PE=2 SV=1 46 239 1.0E-30
sp|P93256|GCST_MESCR Aminomethyltransferase, mitochondrial OS=Mesembryanthemum crystallinum GN=GDCST PE=2 SV=1 33 228 2.0E-30
sp|P54260|GCST_SOLTU Aminomethyltransferase, mitochondrial OS=Solanum tuberosum GN=GDCST PE=2 SV=1 33 224 3.0E-30
sp|A4SDB4|GCST_CHLPM Aminomethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gcvT PE=3 SV=1 52 221 3.0E-30
sp|O23936|GCST_FLATR Aminomethyltransferase, mitochondrial OS=Flaveria trinervia GN=GDCST PE=3 SV=1 46 239 3.0E-30
sp|B2A2T4|GCST_NATTJ Aminomethyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gcvT PE=3 SV=1 52 209 2.0E-29
sp|B3QLF1|GCST_CHLP8 Aminomethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gcvT PE=3 SV=1 52 208 2.0E-29
sp|B4SED4|GCST_PELPB Aminomethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gcvT PE=3 SV=1 52 208 8.0E-29
sp|Q3AQ17|GCST_CHLCH Aminomethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=gcvT PE=3 SV=1 52 228 1.0E-28
sp|Q9TSZ7|GCST_CANLF Aminomethyltransferase, mitochondrial OS=Canis lupus familiaris GN=AMT PE=3 SV=1 47 227 3.0E-28
sp|B4S437|GCST_PROA2 Aminomethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gcvT PE=3 SV=1 52 208 2.0E-27
sp|B3EFX7|GCST_CHLL2 Aminomethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gcvT PE=3 SV=1 52 215 6.0E-27
sp|P28337|GCST_CHICK Aminomethyltransferase, mitochondrial OS=Gallus gallus GN=AMT PE=2 SV=2 45 223 8.0E-27
sp|Q5SKX0|GCST_THET8 Aminomethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gcvT PE=3 SV=1 52 218 1.0E-26
sp|A1BI02|GCST_CHLPD Aminomethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gcvT PE=3 SV=1 52 234 2.0E-26
sp|Q8KBJ9|GCST_CHLTE Aminomethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gcvT PE=3 SV=1 52 208 6.0E-26
sp|Q72LB1|GCST_THET2 Aminomethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gcvT PE=3 SV=1 52 220 8.0E-26
sp|Q67N36|GCST_SYMTH Aminomethyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gcvT PE=3 SV=1 52 209 1.0E-25
sp|Q9WY54|GCST_THEMA Aminomethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gcvT PE=1 SV=1 52 217 2.0E-25
sp|B1L9U1|GCST_THESQ Aminomethyltransferase OS=Thermotoga sp. (strain RQ2) GN=gcvT PE=3 SV=1 52 217 2.0E-25
sp|C1D0F7|GCST_DEIDV Aminomethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gcvT PE=3 SV=1 44 219 3.0E-25
sp|B9K6R7|GCST_THENN Aminomethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gcvT PE=3 SV=1 52 231 3.0E-25
sp|A8MEG4|GCST_ALKOO Aminomethyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=gcvT PE=3 SV=1 52 225 7.0E-25
sp|B8DFY0|GCST_LISMH Aminomethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gcvT PE=3 SV=1 53 223 8.0E-25
sp|Q8CXD9|GCST_OCEIH Aminomethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gcvT PE=3 SV=2 49 209 1.0E-24
sp|Q7V9I2|GCST_PROMA Aminomethyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gcvT PE=3 SV=1 50 216 2.0E-24
sp|Q6MQ03|GCST_BDEBA Aminomethyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gcvT PE=3 SV=1 52 207 2.0E-24
sp|B0SQA1|GCST_LEPBP Aminomethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gcvT PE=3 SV=1 52 216 2.0E-24
sp|B0SGN8|GCST_LEPBA Aminomethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gcvT PE=3 SV=1 52 216 2.0E-24
sp|A5IKL0|GCST_THEP1 Aminomethyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gcvT PE=3 SV=1 52 217 2.0E-24
sp|Q71ZX4|GCST_LISMF Aminomethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gcvT PE=3 SV=1 53 223 2.0E-24
sp|B8D1D7|GCST_HALOH Aminomethyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gcvT PE=3 SV=1 52 222 2.0E-24
sp|C1L2Q4|GCST_LISMC Aminomethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gcvT PE=3 SV=1 53 223 2.0E-24
sp|B3QV24|GCST_CHLT3 Aminomethyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gcvT PE=3 SV=1 54 230 2.0E-24
sp|B0TZJ8|GCST_FRAP2 Aminomethyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gcvT PE=3 SV=1 53 230 3.0E-24
sp|B1HSN7|GCST_LYSSC Aminomethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=gcvT PE=3 SV=1 52 216 4.0E-24
sp|A9B2Q5|GCST_HERA2 Aminomethyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gcvT PE=3 SV=1 52 208 4.0E-24
sp|A8GIS1|GCST_SERP5 Aminomethyltransferase OS=Serratia proteamaculans (strain 568) GN=gcvT PE=3 SV=1 52 206 4.0E-24
sp|Q2RH46|GCST_MOOTA Aminomethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=gcvT PE=3 SV=1 52 209 4.0E-24
sp|A8LFB7|GCST_FRASN Aminomethyltransferase OS=Frankia sp. (strain EAN1pec) GN=gcvT PE=3 SV=1 53 228 6.0E-24
sp|A4J2F6|GCST_DESRM Aminomethyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=gcvT PE=3 SV=1 52 216 6.0E-24
sp|Q8Y7D5|GCST_LISMO Aminomethyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gcvT PE=3 SV=1 53 223 6.0E-24
sp|Q6D976|GCST_PECAS Aminomethyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gcvT PE=3 SV=1 52 215 7.0E-24
sp|Q055P6|GCST_LEPBL Aminomethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gcvT PE=3 SV=1 49 222 7.0E-24
sp|C6D8W9|GCST_PECCP Aminomethyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gcvT PE=3 SV=1 52 215 8.0E-24
sp|Q04PM9|GCST_LEPBJ Aminomethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gcvT PE=3 SV=1 49 222 1.0E-23
sp|Q7N197|GCST_PHOLL Aminomethyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gcvT PE=3 SV=1 52 215 1.0E-23
sp|Q7NFJ5|GCST_GLOVI Aminomethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=gcvT PE=3 SV=2 49 221 1.0E-23
sp|Q15PU4|GCST_PSEA6 Aminomethyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gcvT PE=3 SV=1 52 206 2.0E-23
sp|A0AIE9|GCST_LISW6 Aminomethyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gcvT PE=3 SV=1 53 223 2.0E-23
sp|A8F8M9|GCST_PSELT Aminomethyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gcvT PE=3 SV=1 53 217 2.0E-23
sp|Q9K934|GCST_BACHD Aminomethyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gcvT PE=3 SV=1 52 209 2.0E-23
sp|Q3AET7|GCST_CARHZ Aminomethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gcvT PE=3 SV=1 52 226 2.0E-23
sp|Q8F935|GCST_LEPIN Aminomethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gcvT PE=3 SV=2 49 222 3.0E-23
sp|Q72VI6|GCST_LEPIC Aminomethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gcvT PE=3 SV=2 49 222 3.0E-23
sp|B4SSE0|GCST_STRM5 Aminomethyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gcvT PE=3 SV=1 52 217 3.0E-23
sp|A6TMY6|GCST_ALKMQ Aminomethyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=gcvT PE=3 SV=1 52 223 4.0E-23
sp|A7Z6M4|GCST_BACMF Aminomethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gcvT PE=3 SV=1 52 221 5.0E-23
sp|B0KD95|GCST_THEP3 Aminomethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gcvT PE=3 SV=1 52 223 6.0E-23
sp|B1JNS6|GCST_YERPY Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gcvT PE=3 SV=1 52 215 6.0E-23
sp|A4TIA5|GCST_YERPP Aminomethyltransferase OS=Yersinia pestis (strain Pestoides F) GN=gcvT PE=3 SV=1 52 215 7.0E-23
sp|Q1CEZ7|GCST_YERPN Aminomethyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gcvT PE=3 SV=1 52 215 7.0E-23
sp|A9R4K6|GCST_YERPG Aminomethyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gcvT PE=3 SV=1 52 215 7.0E-23
sp|Q8ZHI6|GCST_YERPE Aminomethyltransferase OS=Yersinia pestis GN=gcvT PE=3 SV=1 52 215 7.0E-23
sp|B2K0Q5|GCST_YERPB Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gcvT PE=3 SV=1 52 215 7.0E-23
sp|Q1CB44|GCST_YERPA Aminomethyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gcvT PE=3 SV=1 52 215 7.0E-23
sp|O86567|GCST_STRCO Aminomethyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gcvT PE=3 SV=1 53 224 7.0E-23
sp|B0K242|GCST_THEPX Aminomethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=gcvT PE=3 SV=1 52 223 7.0E-23
sp|Q92C06|GCST_LISIN Aminomethyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gcvT PE=3 SV=1 53 208 1.0E-22
sp|Q54DD3|GCST_DICDI Aminomethyltransferase, mitochondrial OS=Dictyostelium discoideum GN=gcvT PE=3 SV=1 46 223 1.0E-22
sp|A1JPN6|GCST_YERE8 Aminomethyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gcvT PE=3 SV=1 52 215 1.0E-22
sp|Q24TH3|GCST_DESHY Aminomethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=gcvT PE=3 SV=1 52 239 1.0E-22
sp|A8H7T1|GCST_SHEPA Aminomethyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gcvT PE=3 SV=1 52 224 1.0E-22
sp|B8FT33|GCST_DESHD Aminomethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=gcvT PE=3 SV=1 52 239 1.0E-22
sp|Q1AR89|GCST_RUBXD Aminomethyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gcvT PE=3 SV=1 45 223 2.0E-22
sp|B1KWD5|GCST_CLOBM Aminomethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gcvT PE=3 SV=1 54 239 2.0E-22
sp|Q486J8|GCST_COLP3 Aminomethyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gcvT PE=3 SV=1 52 215 2.0E-22
sp|B2FR21|GCST_STRMK Aminomethyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=gcvT PE=3 SV=1 52 221 2.0E-22
sp|C1FTW3|GCST_CLOBJ Aminomethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gcvT PE=3 SV=1 54 239 3.0E-22
sp|B4RSJ5|GCST_ALTMD Aminomethyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=gcvT PE=3 SV=1 52 206 3.0E-22
sp|A3QHI2|GCST_SHELP Aminomethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gcvT PE=3 SV=1 52 224 3.0E-22
sp|A4IQV5|GCST_GEOTN Aminomethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gcvT PE=3 SV=1 52 221 3.0E-22
sp|B4F0N9|GCST_PROMH Aminomethyltransferase OS=Proteus mirabilis (strain HI4320) GN=gcvT PE=3 SV=1 52 214 3.0E-22
sp|B7GH71|GCST_ANOFW Aminomethyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gcvT PE=3 SV=1 52 222 4.0E-22
sp|C5BAT2|GCST_EDWI9 Aminomethyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=gcvT PE=3 SV=1 52 214 4.0E-22
sp|B9DNN7|GCST_STACT Aminomethyltransferase OS=Staphylococcus carnosus (strain TM300) GN=gcvT PE=3 SV=1 52 218 4.0E-22
sp|Q666R5|GCST_YERPS Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gcvT PE=3 SV=1 52 215 4.0E-22
sp|A7FF19|GCST_YERP3 Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gcvT PE=3 SV=1 52 215 4.0E-22
sp|Q4L6N7|GCST_STAHJ Aminomethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gcvT PE=3 SV=1 49 218 5.0E-22
sp|P54378|GCST_BACSU Aminomethyltransferase OS=Bacillus subtilis (strain 168) GN=gcvT PE=1 SV=2 52 210 5.0E-22
sp|B1IEV3|GCST_CLOBK Aminomethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=gcvT PE=3 SV=1 54 239 6.0E-22
sp|A6TDR7|GCST_KLEP7 Aminomethyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gcvT PE=3 SV=1 52 227 7.0E-22
sp|A0Q585|GCST_FRATN Aminomethyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=gcvT PE=3 SV=1 53 216 7.0E-22
sp|Q8RCV9|GCST_CALS4 Aminomethyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gcvT PE=3 SV=1 52 223 8.0E-22
sp|A7FRV3|GCST_CLOB1 Aminomethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gcvT PE=3 SV=1 54 239 1.0E-21
sp|B2SFM1|GCST_FRATM Aminomethyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gcvT PE=3 SV=1 53 216 1.0E-21
sp|O32955|GCST_MYCLE Aminomethyltransferase OS=Mycobacterium leprae (strain TN) GN=gcvT PE=3 SV=1 53 208 1.0E-21
sp|B8ZQK6|GCST_MYCLB Aminomethyltransferase OS=Mycobacterium leprae (strain Br4923) GN=gcvT PE=3 SV=1 53 208 1.0E-21
sp|B2JJ71|GCST_BURP8 Aminomethyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gcvT PE=3 SV=1 48 206 1.0E-21
sp|A8FZK6|GCST_SHESH Aminomethyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=gcvT PE=3 SV=1 52 224 1.0E-21
sp|B1XP99|GCST_SYNP2 Aminomethyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gcvT PE=3 SV=1 52 225 1.0E-21
sp|B7N7E8|GCST_ECOLU Aminomethyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|B8CK16|GCST_SHEPW Aminomethyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=gcvT PE=3 SV=1 52 224 2.0E-21
sp|A4IZK8|GCST_FRATW Aminomethyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gcvT PE=3 SV=1 53 216 2.0E-21
sp|A7GB83|GCST_CLOBL Aminomethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gcvT PE=3 SV=1 54 239 2.0E-21
sp|Q5NHP0|GCST_FRATT Aminomethyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gcvT PE=3 SV=1 53 216 2.0E-21
sp|Q14J42|GCST_FRAT1 Aminomethyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gcvT PE=3 SV=1 53 216 2.0E-21
sp|B7LPB9|GCST_ESCF3 Aminomethyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|Q1R7C6|GCST_ECOUT Aminomethyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|B7NHW6|GCST_ECO7I Aminomethyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|B7MM91|GCST_ECO45 Aminomethyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|B7UHV3|GCST_ECO27 Aminomethyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|Q3YXW5|GCST_SHISS Aminomethyltransferase OS=Shigella sonnei (strain Ss046) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|C3L1M5|GCST_CLOB6 Aminomethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gcvT PE=3 SV=1 54 239 2.0E-21
sp|Q32BW7|GCST_SHIDS Aminomethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|B7MZ57|GCST_ECO81 Aminomethyltransferase OS=Escherichia coli O81 (strain ED1a) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|B1YLN6|GCST_EXIS2 Aminomethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gcvT PE=3 SV=1 47 217 2.0E-21
sp|B1LDA5|GCST_ECOSM Aminomethyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|A7MR82|GCST_CROS8 Aminomethyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gcvT PE=3 SV=1 52 224 2.0E-21
sp|B2U0S2|GCST_SHIB3 Aminomethyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gcvT PE=3 SV=1 52 227 2.0E-21
sp|Q83JU1|GCST_SHIFL Aminomethyltransferase OS=Shigella flexneri GN=gcvT PE=3 SV=1 52 224 2.0E-21
sp|Q0BN73|GCST_FRATO Aminomethyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gcvT PE=3 SV=1 53 216 2.0E-21
sp|Q2A4V3|GCST_FRATH Aminomethyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gcvT PE=3 SV=1 53 216 2.0E-21
sp|A7NAH6|GCST_FRATF Aminomethyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gcvT PE=3 SV=1 53 216 2.0E-21
sp|Q31WG6|GCST_SHIBS Aminomethyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|B6I738|GCST_ECOSE Aminomethyltransferase OS=Escherichia coli (strain SE11) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|P27248|GCST_ECOLI Aminomethyltransferase OS=Escherichia coli (strain K12) GN=gcvT PE=1 SV=3 52 227 3.0E-21
sp|B1IT97|GCST_ECOLC Aminomethyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|A8A446|GCST_ECOHS Aminomethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|C5A0H7|GCST_ECOBW Aminomethyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|B7LYG9|GCST_ECO8A Aminomethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|B7LF91|GCST_ECO55 Aminomethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|A7ZR14|GCST_ECO24 Aminomethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|B5YQ97|GCST_ECO5E Aminomethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|Q8XD32|GCST_ECO57 Aminomethyltransferase OS=Escherichia coli O157:H7 GN=gcvT PE=3 SV=1 52 227 3.0E-21
sp|Q83B06|GCST_COXBU Aminomethyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gcvT PE=3 SV=1 54 217 3.0E-21
sp|P9WN51|GCST_MYCTU Aminomethyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gcvT PE=1 SV=1 55 226 3.0E-21
sp|P9WN50|GCST_MYCTO Aminomethyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gcvT PE=3 SV=1 55 226 3.0E-21
sp|P64221|GCST_MYCBO Aminomethyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gcvT PE=3 SV=1 55 226 3.0E-21
sp|Q7MUG4|GCST_PORGI Aminomethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gcvT PE=3 SV=1 54 241 4.0E-21
sp|B2RI74|GCST_PORG3 Aminomethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gcvT PE=3 SV=1 54 241 4.0E-21
sp|Q2NRE8|GCST_SODGM Aminomethyltransferase OS=Sodalis glossinidius (strain morsitans) GN=gcvT PE=3 SV=1 52 215 4.0E-21
sp|Q49XY1|GCST_STAS1 Aminomethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gcvT PE=3 SV=1 52 209 4.0E-21
sp|B0TSG7|GCST_SHEHH Aminomethyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gcvT PE=3 SV=1 52 204 4.0E-21
sp|Q4JXU5|GCST_CORJK Aminomethyltransferase OS=Corynebacterium jeikeium (strain K411) GN=gcvT PE=3 SV=1 53 217 4.0E-21
sp|C1F933|GCST_ACIC5 Aminomethyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gcvT PE=3 SV=1 44 239 5.0E-21
sp|A1WWA3|GCST_HALHL Aminomethyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gcvT PE=3 SV=1 52 208 5.0E-21
sp|Q5QVA8|GCST_IDILO Aminomethyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gcvT PE=3 SV=1 52 215 6.0E-21
sp|Q7TUI6|GCST_PROMM Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=gcvT PE=3 SV=1 54 208 8.0E-21
sp|A2CDX3|GCST_PROM3 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=gcvT PE=3 SV=1 54 208 8.0E-21
sp|Q8PI37|GCST_XANAC Aminomethyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gcvT PE=3 SV=1 52 212 9.0E-21
sp|Q5KX76|GCST_GEOKA Aminomethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=gcvT PE=3 SV=1 52 209 9.0E-21
sp|Q0RFF6|GCST_FRAAA Aminomethyltransferase OS=Frankia alni (strain ACN14a) GN=gcvT PE=3 SV=1 53 228 1.0E-20
sp|Q3BQN6|GCST_XANC5 Aminomethyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gcvT PE=3 SV=1 52 212 1.0E-20
sp|Q82JI2|GCST_STRAW Aminomethyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gcvT PE=3 SV=1 52 224 1.0E-20
sp|Q8FE65|GCST_ECOL6 Aminomethyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gcvT PE=3 SV=1 52 227 1.0E-20
sp|A8FF41|GCST_BACP2 Aminomethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=gcvT PE=3 SV=1 52 216 2.0E-20
sp|B8GNE2|GCST_THISH Aminomethyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gcvT PE=3 SV=1 52 217 2.0E-20
sp|B7K468|GCST_CYAP8 Aminomethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=gcvT PE=3 SV=1 53 225 2.0E-20
sp|Q3IFV9|GCST_PSEHT Aminomethyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gcvT PE=3 SV=1 52 204 2.0E-20
sp|Q0T0Z3|GCST_SHIF8 Aminomethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=gcvT PE=3 SV=1 52 224 2.0E-20
sp|C5D4A2|GCST_GEOSW Aminomethyltransferase OS=Geobacillus sp. (strain WCH70) GN=gcvT PE=3 SV=1 52 216 2.0E-20
sp|A4WE57|GCST_ENT38 Aminomethyltransferase OS=Enterobacter sp. (strain 638) GN=gcvT PE=3 SV=1 52 204 2.0E-20
sp|Q9UZP8|GCST_PYRAB Probable aminomethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gcvT PE=3 SV=1 56 231 2.0E-20
sp|A1S967|GCST_SHEAM Aminomethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gcvT PE=3 SV=1 52 204 2.0E-20
sp|B2SSQ1|GCST_XANOP Aminomethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gcvT PE=3 SV=1 52 212 3.0E-20
sp|Q5H1X3|GCST_XANOR Aminomethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gcvT PE=3 SV=1 52 212 3.0E-20
sp|Q2P4S5|GCST_XANOM Aminomethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gcvT PE=3 SV=1 52 212 3.0E-20
sp|Q8P6T8|GCST_XANCP Aminomethyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gcvT PE=3 SV=1 52 212 3.0E-20
sp|Q4UXC2|GCST_XANC8 Aminomethyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gcvT PE=3 SV=1 52 212 3.0E-20
sp|A9VH12|GCST_BACWK Aminomethyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=gcvT PE=3 SV=1 53 225 3.0E-20
sp|B2VF35|GCST_ERWT9 Aminomethyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gcvT PE=3 SV=1 53 227 4.0E-20
sp|A8G7J2|GCST_PROM2 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=gcvT PE=3 SV=1 53 216 5.0E-20
sp|B7IXL4|GCST_BACC2 Aminomethyltransferase OS=Bacillus cereus (strain G9842) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|Q634V6|GCST_BACCZ Aminomethyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|Q6HDT6|GCST_BACHK Aminomethyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|Q818M3|GCST_BACCR Aminomethyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|B7JMV1|GCST_BACC0 Aminomethyltransferase OS=Bacillus cereus (strain AH820) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|Q81M06|GCST_BACAN Aminomethyltransferase OS=Bacillus anthracis GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|C3LKQ4|GCST_BACAC Aminomethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|C3P8D5|GCST_BACAA Aminomethyltransferase OS=Bacillus anthracis (strain A0248) GN=gcvT PE=3 SV=1 53 225 5.0E-20
sp|A3PFH6|GCST_PROM0 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=gcvT PE=3 SV=1 53 216 5.0E-20
sp|B7HBA0|GCST_BACC4 Aminomethyltransferase OS=Bacillus cereus (strain B4264) GN=gcvT PE=3 SV=1 53 216 6.0E-20
sp|C1ERV0|GCST_BACC3 Aminomethyltransferase OS=Bacillus cereus (strain 03BB102) GN=gcvT PE=3 SV=1 53 225 6.0E-20
sp|A0RIL1|GCST_BACAH Aminomethyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=gcvT PE=3 SV=1 53 225 6.0E-20
sp|Q7WP31|GCST_BORBR Aminomethyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gcvT PE=3 SV=1 52 204 6.0E-20
sp|B9IXL9|GCST_BACCQ Aminomethyltransferase OS=Bacillus cereus (strain Q1) GN=gcvT PE=3 SV=1 53 225 6.0E-20
sp|B7HNZ1|GCST_BACC7 Aminomethyltransferase OS=Bacillus cereus (strain AH187) GN=gcvT PE=3 SV=1 53 225 6.0E-20
sp|Q730W1|GCST_BACC1 Aminomethyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gcvT PE=3 SV=1 53 225 6.0E-20
sp|A8APB4|GCST_CITK8 Aminomethyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gcvT PE=3 SV=1 52 204 7.0E-20
sp|P64226|GCST_STAAW Aminomethyltransferase OS=Staphylococcus aureus (strain MW2) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|A8Z476|GCST_STAAT Aminomethyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|Q6G929|GCST_STAAS Aminomethyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|P64225|GCST_STAAN Aminomethyltransferase OS=Staphylococcus aureus (strain N315) GN=gcvT PE=1 SV=1 49 216 7.0E-20
sp|P64224|GCST_STAAM Aminomethyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|A6QH81|GCST_STAAE Aminomethyltransferase OS=Staphylococcus aureus (strain Newman) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|Q5HFM2|GCST_STAAC Aminomethyltransferase OS=Staphylococcus aureus (strain COL) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|A5IT65|GCST_STAA9 Aminomethyltransferase OS=Staphylococcus aureus (strain JH9) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|Q2FY33|GCST_STAA8 Aminomethyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|Q2FGI5|GCST_STAA3 Aminomethyltransferase OS=Staphylococcus aureus (strain USA300) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|A6U208|GCST_STAA2 Aminomethyltransferase OS=Staphylococcus aureus (strain JH1) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|A7X2S3|GCST_STAA1 Aminomethyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|Q6GGG2|GCST_STAAR Aminomethyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=gcvT PE=3 SV=1 49 216 7.0E-20
sp|Q5WF30|GCST_BACSK Aminomethyltransferase OS=Bacillus clausii (strain KSM-K16) GN=gcvT PE=3 SV=1 48 209 8.0E-20
sp|Q7W1C6|GCST_BORPA Aminomethyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gcvT PE=3 SV=1 52 204 8.0E-20
sp|Q8YNF7|GCST_NOSS1 Aminomethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gcvT PE=3 SV=1 52 216 8.0E-20
sp|A7GSN8|GCST_BACCN Aminomethyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gcvT PE=3 SV=1 53 225 9.0E-20
sp|C5BM95|GCST_TERTT Aminomethyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gcvT PE=3 SV=1 52 214 1.0E-19
sp|Q65HF9|GCST_BACLD Aminomethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gcvT PE=3 SV=1 52 209 1.0E-19
sp|Q8DKV6|GCST_THEEB Aminomethyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=gcvT PE=3 SV=1 52 208 1.0E-19
sp|P54261|GCST_SYNY3 Aminomethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gcvT PE=3 SV=1 53 216 1.0E-19
sp|Q1INT8|GCST_KORVE Aminomethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=gcvT PE=3 SV=1 47 223 1.0E-19
sp|Q0VLA6|GCST_ALCBS Aminomethyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gcvT PE=3 SV=1 53 208 1.0E-19
sp|A5GPL8|GCST_SYNPW Aminomethyltransferase OS=Synechococcus sp. (strain WH7803) GN=gcvT PE=3 SV=1 53 204 1.0E-19
sp|B1KG89|GCST_SHEWM Aminomethyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gcvT PE=3 SV=1 52 224 1.0E-19
sp|Q7W0E5|GCST_BORPE Aminomethyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gcvT PE=3 SV=1 52 204 1.0E-19
sp|Q39KT9|GCST_BURL3 Aminomethyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|P64222|GCST_SALTY Aminomethyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|P64223|GCST_SALTI Aminomethyltransferase OS=Salmonella typhi GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B4TV24|GCST_SALSV Aminomethyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B5BFM0|GCST_SALPK Aminomethyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|Q5PJG4|GCST_SALPA Aminomethyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B5F5I0|GCST_SALA4 Aminomethyltransferase OS=Salmonella agona (strain SL483) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|C0PY28|GCST_SALPC Aminomethyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B4T550|GCST_SALNS Aminomethyltransferase OS=Salmonella newport (strain SL254) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B4TGX5|GCST_SALHS Aminomethyltransferase OS=Salmonella heidelberg (strain SL476) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|Q57K60|GCST_SALCH Aminomethyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|Q2YSZ2|GCST_STAAB Aminomethyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gcvT PE=3 SV=1 49 216 2.0E-19
sp|A9N3N3|GCST_SALPB Aminomethyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|A9MRH0|GCST_SALAR Aminomethyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B5RE16|GCST_SALG2 Aminomethyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B5QXI2|GCST_SALEP Aminomethyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|B5FUG8|GCST_SALDC Aminomethyltransferase OS=Salmonella dublin (strain CT_02021853) GN=gcvT PE=3 SV=1 52 206 2.0E-19
sp|A0QEZ6|GCST_MYCA1 Aminomethyltransferase OS=Mycobacterium avium (strain 104) GN=gcvT PE=3 SV=1 46 217 2.0E-19
sp|Q07YC7|GCST_SHEFN Aminomethyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gcvT PE=3 SV=1 52 204 3.0E-19
sp|A6L8T3|GCST_PARD8 Aminomethyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gcvT PE=3 SV=1 54 209 3.0E-19
sp|Q63PL4|GCST_BURPS Aminomethyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=gcvT PE=3 SV=1 54 204 3.0E-19
sp|A3NEZ8|GCST_BURP6 Aminomethyltransferase OS=Burkholderia pseudomallei (strain 668) GN=gcvT PE=3 SV=1 54 204 3.0E-19
sp|A3P0U5|GCST_BURP0 Aminomethyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=gcvT PE=3 SV=1 54 204 3.0E-19
sp|Q62FM9|GCST_BURMA Aminomethyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=gcvT PE=3 SV=1 54 204 3.0E-19
sp|A2S6F4|GCST_BURM9 Aminomethyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=gcvT PE=3 SV=1 54 204 3.0E-19
sp|A3MQP5|GCST_BURM7 Aminomethyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=gcvT PE=3 SV=1 54 204 3.0E-19
sp|Q0I682|GCST_SYNS3 Aminomethyltransferase OS=Synechococcus sp. (strain CC9311) GN=gcvT PE=3 SV=1 51 216 3.0E-19
sp|A9ACU5|GCST_BURM1 Aminomethyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gcvT PE=3 SV=1 50 206 4.0E-19
sp|B8EB47|GCST_SHEB2 Aminomethyltransferase OS=Shewanella baltica (strain OS223) GN=gcvT PE=3 SV=1 52 227 4.0E-19
sp|Q88CI7|GCST_PSEPK Aminomethyltransferase OS=Pseudomonas putida (strain KT2440) GN=gcvT PE=3 SV=1 52 206 4.0E-19
sp|Q0HZ30|GCST_SHESR Aminomethyltransferase OS=Shewanella sp. (strain MR-7) GN=gcvT PE=3 SV=1 52 204 4.0E-19
sp|Q0HEX0|GCST_SHESM Aminomethyltransferase OS=Shewanella sp. (strain MR-4) GN=gcvT PE=3 SV=1 52 204 4.0E-19
sp|O58888|GCST_PYRHO Probable aminomethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gcvT PE=1 SV=2 56 231 5.0E-19
sp|Q8EIQ8|GCST_SHEON Aminomethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=gcvT PE=3 SV=1 52 204 5.0E-19
sp|A6LP67|GCST_THEM4 Aminomethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gcvT PE=3 SV=1 54 217 5.0E-19
sp|A0L105|GCST_SHESA Aminomethyltransferase OS=Shewanella sp. (strain ANA-3) GN=gcvT PE=3 SV=1 52 204 5.0E-19
sp|A3D083|GCST_SHEB5 Aminomethyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gcvT PE=3 SV=1 52 204 5.0E-19
sp|A6WSL3|GCST_SHEB8 Aminomethyltransferase OS=Shewanella baltica (strain OS185) GN=gcvT PE=3 SV=1 52 204 5.0E-19
sp|A0KJ03|GCST_AERHH Aminomethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gcvT PE=3 SV=1 56 201 5.0E-19
sp|A9L332|GCST_SHEB9 Aminomethyltransferase OS=Shewanella baltica (strain OS195) GN=gcvT PE=3 SV=1 52 204 5.0E-19
sp|C3PHK3|GCST_CORA7 Aminomethyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=gcvT PE=3 SV=1 49 208 6.0E-19
sp|Q9JVP2|GCST_NEIMA Aminomethyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gcvT PE=3 SV=2 54 208 6.0E-19
sp|A1RFY6|GCST_SHESW Aminomethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=gcvT PE=3 SV=1 52 204 7.0E-19
sp|A4YAE0|GCST_SHEPC Aminomethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gcvT PE=3 SV=1 52 204 7.0E-19
sp|B1JSZ4|GCST_BURCC Aminomethyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=gcvT PE=3 SV=1 52 206 8.0E-19
sp|Q7TTS1|GCST_SYNPX Aminomethyltransferase OS=Synechococcus sp. (strain WH8102) GN=gcvT PE=3 SV=1 52 221 8.0E-19
sp|B4EF28|GCST_BURCJ Aminomethyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gcvT PE=3 SV=1 52 206 9.0E-19
sp|Q73YK4|GCST_MYCPA Aminomethyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gcvT PE=3 SV=1 46 217 9.0E-19
sp|Q60BW3|GCST_METCA Aminomethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gcvT PE=3 SV=1 56 202 9.0E-19
sp|A6L6X5|GCST_BACV8 Aminomethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gcvT PE=3 SV=1 54 209 1.0E-18
sp|Q2KYM2|GCST_BORA1 Aminomethyltransferase OS=Bordetella avium (strain 197N) GN=gcvT PE=3 SV=1 46 204 1.0E-18
sp|Q9K0L8|GCST_NEIMB Aminomethyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gcvT PE=3 SV=1 54 208 1.0E-18
sp|B1YQQ3|GCST_BURA4 Aminomethyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=gcvT PE=3 SV=1 52 206 1.0E-18
sp|A6GXW3|GCST_FLAPJ Aminomethyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=gcvT PE=3 SV=1 53 216 1.0E-18
sp|A2BTR9|GCST_PROMS Aminomethyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=gcvT PE=3 SV=1 53 201 2.0E-18
sp|Q64WS3|GCST_BACFR Aminomethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=gcvT PE=3 SV=1 54 172 2.0E-18
sp|Q5LFT6|GCST_BACFN Aminomethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gcvT PE=3 SV=1 54 172 2.0E-18
sp|Q8CSF4|GCST_STAES Aminomethyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gcvT PE=3 SV=1 53 202 2.0E-18
sp|Q5HP12|GCST_STAEQ Aminomethyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gcvT PE=3 SV=1 53 202 2.0E-18
sp|A9I7L6|GCST_BORPD Aminomethyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gcvT PE=3 SV=1 52 204 2.0E-18
sp|A4JA71|GCST_BURVG Aminomethyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gcvT PE=3 SV=1 52 206 2.0E-18
sp|Q8XUA0|GCST_RALSO Aminomethyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=gcvT PE=3 SV=1 54 204 2.0E-18
sp|Q7NSJ3|GCST_CHRVO Aminomethyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gcvT PE=3 SV=1 52 206 2.0E-18
sp|Q3JDS3|GCST_NITOC Aminomethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gcvT PE=3 SV=1 50 204 3.0E-18
sp|B3PI82|GCST_CELJU Aminomethyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=gcvT PE=3 SV=1 52 215 3.0E-18
sp|A4SP35|GCST_AERS4 Aminomethyltransferase OS=Aeromonas salmonicida (strain A449) GN=gcvT PE=3 SV=1 56 204 4.0E-18
sp|B0U270|GCST_XYLFM Aminomethyltransferase OS=Xylella fastidiosa (strain M12) GN=gcvT PE=3 SV=1 52 221 4.0E-18
sp|Q12R04|GCST_SHEDO Aminomethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gcvT PE=3 SV=1 52 204 4.0E-18
sp|Q7TU18|GCST_PROMP Aminomethyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gcvT PE=3 SV=1 53 216 4.0E-18
sp|Q9PGW5|GCST_XYLFA Aminomethyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=gcvT PE=3 SV=1 52 221 4.0E-18
sp|C5A3P0|GCST_THEGJ Probable aminomethyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gcvT PE=3 SV=1 56 231 5.0E-18
sp|Q87EZ6|GCST_XYLFT Aminomethyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gcvT PE=3 SV=1 52 221 5.0E-18
sp|B2I6Q1|GCST_XYLF2 Aminomethyltransferase OS=Xylella fastidiosa (strain M23) GN=gcvT PE=3 SV=1 52 221 5.0E-18
sp|Q9HTX5|GCST_PSEAE Aminomethyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gcvT PE=3 SV=1 53 204 6.0E-18
sp|Q8U185|GCST_PYRFU Probable aminomethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gcvT PE=3 SV=1 56 231 7.0E-18
sp|Q5N136|GCST_SYNP6 Aminomethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gcvT PE=3 SV=1 54 216 1.0E-17
sp|Q31KT1|GCST_SYNE7 Aminomethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=gcvT PE=3 SV=1 54 216 1.0E-17
sp|Q3AVT0|GCST_SYNS9 Aminomethyltransferase OS=Synechococcus sp. (strain CC9902) GN=gcvT PE=3 SV=1 53 216 1.0E-17
sp|Q21NX7|GCST_SACD2 Aminomethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gcvT PE=3 SV=1 52 218 2.0E-17
sp|B2UG80|GCST_RALPJ Aminomethyltransferase OS=Ralstonia pickettii (strain 12J) GN=gcvT PE=3 SV=1 54 204 2.0E-17
sp|Q89YZ6|GCST_BACTN Aminomethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gcvT PE=3 SV=1 54 172 2.0E-17
sp|A4FLG1|GCST_SACEN Aminomethyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=gcvT PE=3 SV=1 49 233 3.0E-17
sp|Q5X8W1|GCST_LEGPA Aminomethyltransferase OS=Legionella pneumophila (strain Paris) GN=gcvT PE=3 SV=1 52 204 3.0E-17
sp|Q5ZZ93|GCST_LEGPH Aminomethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gcvT PE=3 SV=2 52 204 4.0E-17
sp|Q1LHM4|GCST_CUPMC Aminomethyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gcvT PE=3 SV=1 54 214 4.0E-17
sp|Q5X0A4|GCST_LEGPL Aminomethyltransferase OS=Legionella pneumophila (strain Lens) GN=gcvT PE=3 SV=1 52 204 4.0E-17
sp|A5I9T7|GCST_LEGPC Aminomethyltransferase OS=Legionella pneumophila (strain Corby) GN=gcvT PE=3 SV=1 52 204 5.0E-17
sp|A2C5F7|GCST_PROM1 Aminomethyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=gcvT PE=3 SV=1 50 216 5.0E-17
sp|O67441|GCST_AQUAE Aminomethyltransferase OS=Aquifex aeolicus (strain VF5) GN=gcvT PE=3 SV=2 53 208 6.0E-17
sp|A2BZ74|GCST_PROM5 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=gcvT PE=3 SV=1 53 180 8.0E-17
sp|Q5JDG3|GCST_THEKO Probable aminomethyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gcvT PE=3 SV=1 56 231 9.0E-17
sp|Q88AS0|GCST_PSESM Aminomethyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gcvT PE=3 SV=1 52 204 1.0E-16
sp|Q82WQ6|GCST_NITEU Aminomethyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gcvT PE=3 SV=1 54 204 1.0E-16
sp|Q46I99|GCST_PROMT Aminomethyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=gcvT PE=3 SV=1 50 216 1.0E-16
sp|A5GWT1|GCST_SYNR3 Aminomethyltransferase OS=Synechococcus sp. (strain RCC307) GN=gcvT PE=3 SV=1 54 205 2.0E-16
sp|Q0AEP7|GCST_NITEC Aminomethyltransferase OS=Nitrosomonas eutropha (strain C91) GN=gcvT PE=3 SV=1 54 230 3.0E-16
sp|B3R7J7|GCST_CUPTR Aminomethyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gcvT PE=3 SV=1 54 204 3.0E-16
sp|Q6A9R6|GCST_PROAC Aminomethyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gcvT PE=3 SV=1 53 212 7.0E-16
sp|Q47D83|GCST_DECAR Aminomethyltransferase OS=Dechloromonas aromatica (strain RCB) GN=gcvT PE=3 SV=1 52 204 8.0E-16
sp|B6YY21|GCST_THEON Probable aminomethyltransferase OS=Thermococcus onnurineus (strain NA1) GN=gcvT PE=3 SV=1 56 231 1.0E-15
sp|Q5YZ49|GCST_NOCFA Aminomethyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=gcvT PE=3 SV=1 48 228 2.0E-15
sp|A0PTP8|GCST_MYCUA Aminomethyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=gcvT PE=3 SV=1 53 163 5.0E-15
sp|Q46VZ7|GCST_CUPPJ Aminomethyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gcvT PE=3 SV=1 54 204 5.0E-15
sp|Q3IN28|GCST_NATPD Probable aminomethyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gcvT PE=3 SV=1 55 221 9.0E-15
sp|Q0K5P5|GCST_CUPNH Aminomethyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gcvT PE=3 SV=1 54 204 1.0E-14
sp|Q5V230|GCST_HALMA Probable aminomethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gcvT PE=3 SV=2 55 208 4.0E-12
sp|Q9HPJ7|GCST_HALSA Probable aminomethyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gcvT PE=3 SV=2 54 221 7.0E-12
sp|B0R5Y8|GCST_HALS3 Probable aminomethyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gcvT PE=3 SV=1 54 221 7.0E-12
sp|Q9YBA2|GCST_AERPE Probable aminomethyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gcvT PE=3 SV=2 56 223 5.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2668
MRSFGSAARSAASRLGQAPRLRSRPWTSAAATAAARQVRLEHSSASAESKHSKSPLHDFHLEHGAKMVGFAGWMM
PLQYGGTSLTESHLFTRSHASLFDVSHMAQHLFRGPRAADFLETVTPSAIGSMAPMQSKLTTLLWPGTGGIVDDM
VVTRLGSAEFHAVTNAGNRAKDEQYLEEQLAGADGVEWTRLPGEGLVALQGPLAAEVLRDALASELDLGRLYFGN
AAWARLRLGDGSACPS*
Coding >Hirsu2|2668
ATGAGGAGCTTCGGATCGGCCGCGCGGTCGGCGGCGTCCCGCCTCGGCCAGGCCCCACGCCTCCGATCCCGGCCC
TGGACCTCGGCGGCGGCGACGGCGGCGGCGCGCCAGGTCCGGCTCGAGCACTCGTCGGCGTCGGCCGAGAGCAAG
CACAGCAAGTCGCCGCTCCACGACTTCCACCTGGAGCACGGCGCCAAGATGGTGGGATTCGCCGGGTGGATGATG
CCGCTGCAGTACGGCGGCACCTCTCTGACCGAGTCGCACCTGTTCACGCGCAGCCACGCGTCGCTGTTCGACGTC
AGCCACATGGCGCAGCACCTCTTCCGCGGGCCGCGGGCCGCCGACTTCCTCGAGACGGTGACGCCGTCGGCCATC
GGCAGCATGGCGCCGATGCAGAGCAAGCTGACGACGCTGCTGTGGCCCGGGACGGGCGGCATCGTCGACGACATG
GTCGTGACGCGGCTCGGCTCGGCCGAGTTCCACGCCGTCACCAACGCGGGCAACCGCGCCAAGGACGAGCAGTAC
CTGGAGGAGCAGCTGGCCGGGGCGGACGGGGTCGAGTGGACGAGGCTCCCCGGCGAGGGCCTGGTGGCGTTGCAG
GGCCCGCTGGCGGCCGAGGTGCTGCGGGACGCGCTGGCGTCGGAGCTCGACCTCGGCCGCCTCTACTTCGGCAAC
GCGGCCTGGGCCCGGCTGCGGCTCGGCGACGGCAGCGCCTGTCCGTCATGA
Transcript >Hirsu2|2668
ATGAGGAGCTTCGGATCGGCCGCGCGGTCGGCGGCGTCCCGCCTCGGCCAGGCCCCACGCCTCCGATCCCGGCCC
TGGACCTCGGCGGCGGCGACGGCGGCGGCGCGCCAGGTCCGGCTCGAGCACTCGTCGGCGTCGGCCGAGAGCAAG
CACAGCAAGTCGCCGCTCCACGACTTCCACCTGGAGCACGGCGCCAAGATGGTGGGATTCGCCGGGTGGATGATG
CCGCTGCAGTACGGCGGCACCTCTCTGACCGAGTCGCACCTGTTCACGCGCAGCCACGCGTCGCTGTTCGACGTC
AGCCACATGGCGCAGCACCTCTTCCGCGGGCCGCGGGCCGCCGACTTCCTCGAGACGGTGACGCCGTCGGCCATC
GGCAGCATGGCGCCGATGCAGAGCAAGCTGACGACGCTGCTGTGGCCCGGGACGGGCGGCATCGTCGACGACATG
GTCGTGACGCGGCTCGGCTCGGCCGAGTTCCACGCCGTCACCAACGCGGGCAACCGCGCCAAGGACGAGCAGTAC
CTGGAGGAGCAGCTGGCCGGGGCGGACGGGGTCGAGTGGACGAGGCTCCCCGGCGAGGGCCTGGTGGCGTTGCAG
GGCCCGCTGGCGGCCGAGGTGCTGCGGGACGCGCTGGCGTCGGAGCTCGACCTCGGCCGCCTCTACTTCGGCAAC
GCGGCCTGGGCCCGGCTGCGGCTCGGCGACGGCAGCGCCTGTCCGTCATGA
Gene >Hirsu2|2668
ATGAGGAGCTTCGGATCGGCCGCGCGGTCGGCGGCGTCCCGCCTCGGCCAGGCCCCACGCCTCCGATCCCGGCCC
TGGACCTCGGCGGCGGCGACGGCGGCGGCGCGCCAGGTCCGGCTCGAGCACTCGTCGGCGTCGGCCGAGAGCAAG
CACAGCAAGTCGCCGCTCCACGACTTCCACCTGGAGCACGGCGCCAAGATGGTGGGATTCGCCGGGTGGATGATG
CCGCTGCAGTACGGCGGCACCTCTCTGACCGAGTCGCACCTGTTCACGCGCAGCCACGCGTCGCTGTTCGACGTC
AGCCACATGGCGCAGCACCTCTTCCGCGGGCCGCGGGCCGCCGACTTCCTCGAGACGGTGACGCCGTCGGCCATC
GGCAGCATGGCGCCGATGCAGAGCAAGCTGACGACGCTGCTGTGGCCCGGGACGGGCGGCATCGTCGACGACATG
GTCGTGACGCGGCTCGGCTCGGCCGAGTTCCACGCCGTCACCAACGCGGGCAACCGCGCCAAGGACGAGCAGTAC
CTGGAGGAGCAGCTGGCCGGGGCGGACGGGGTCGAGTGGACGAGGCTCCCCGGCGAGGGCCTGGTGGCGTTGCAG
GGCCCGCTGGCGGCCGAGGTGCTGCGGGACGCGCTGGCGTCGGAGCTCGACCTCGGCCGCCTCTACTTCGGCAAC
GCGGCCTGGGCCCGGCTGCGGCTCGGCGACGGCAGCGCGTCGCACCCGATCCTCGTCAGCCGCGGCGGCTACACG
GGCGAGGACGGCTTCGAGCTGTCCGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail