Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|266
Gene name
LocationContig_105:8780..10546
Strand-
Gene length (bp)1766
Transcript length (bp)1434
Coding sequence length (bp)1434
Protein length (aa) 478

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 7.9E-150 45 421

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 22 473 2.0E-109
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 32 475 7.0E-106
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 45 475 2.0E-105
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 56 473 1.0E-102
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 39 452 6.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 22 473 2.0E-109
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 32 475 7.0E-106
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 45 475 2.0E-105
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 56 473 1.0E-102
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 39 452 6.0E-102
sp|Q5ACZ2|DFG5_CANAL Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFG5 PE=1 SV=1 38 473 3.0E-95
sp|O74556|YCZ2_SCHPO Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.02 PE=3 SV=1 32 434 5.0E-91
sp|Q9P6I3|YHG7_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.07c PE=3 SV=2 41 460 2.0E-86
sp|Q9P6I4|YHG6_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.06c PE=3 SV=1 82 472 7.0E-73
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 454 476 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|266
MFPSSPPSLSRAWPLVMAGSLLLGGTGAQAPGPASTYKIDTPDNIRESASTLAYDLMLLYPGNKTGGIPGTLPGP
PPAGPYYWWEGGAMMGTYIDYWHLTGDSSYNKVVMEGMLHQVGDKENYMPANHTMSLGNDDQGFWGMSAMLAAEN
KFPNPPDDKPQWLALAQAVWNTQADPSRHDTTCGGGLRWQIPFANAGYNYKNTIANGCFFNIGARLARYTKNATY
AEWADKTWDWLWGVHFIDHESWRVYDGAHVEANCTDINKATFSYNIGVLLQGAAFMYNFTEGDRKWADRVDKLTE
RILADFFPKKIAFEVPCEVRKGACSPDMLSFKGYVHRWLSVVTQVAPFTRDKILPVLRTSTEAAVKQCTGGETGR
MCGFYWSEGVFIDPGVDHTSGAGETMNVLAAVSSLLIDGNGGPVTNATGGISKGNPNAGGGRDNGERAPRPITGG
DRAGAGILTFLLLGSAVGTFVWMSLFE*
Coding >Hirsu2|266
ATGTTTCCCTCGTCACCTCCAAGCCTGTCCCGGGCATGGCCACTGGTTATGGCTGGAAGCCTGCTCTTGGGCGGC
ACTGGGGCCCAGGCACCGGGGCCGGCCTCGACATACAAGATCGATACTCCCGATAACATCCGCGAGTCGGCCAGC
ACCTTGGCCTACGACCTGATGCTCCTGTACCCGGGCAACAAGACGGGCGGCATCCCGGGCACCCTGCCTGGCCCG
CCCCCGGCCGGACCATACTACTGGTGGGAAGGCGGCGCCATGATGGGCACCTACATCGACTACTGGCACCTGACG
GGCGATTCCAGCTACAACAAGGTCGTCATGGAGGGCATGCTGCACCAGGTCGGCGACAAGGAGAACTACATGCCC
GCCAACCACACCATGTCGCTCGGCAACGACGATCAAGGCTTCTGGGGCATGTCCGCCATGCTGGCCGCCGAGAAC
AAGTTCCCTAATCCGCCCGACGATAAGCCCCAGTGGCTGGCCCTGGCCCAAGCCGTCTGGAATACCCAGGCTGAT
CCCAGCCGCCACGATACCACCTGCGGCGGCGGACTACGCTGGCAGATTCCCTTCGCCAACGCCGGATACAACTAC
AAGAACACCATCGCCAACGGGTGTTTCTTCAATATCGGGGCACGACTGGCGCGCTATACCAAGAACGCGACATAT
GCCGAATGGGCCGACAAGACGTGGGACTGGCTCTGGGGCGTTCACTTCATCGACCACGAGTCGTGGCGCGTCTAC
GACGGCGCCCACGTCGAGGCAAACTGCACCGACATCAACAAGGCCACCTTCTCCTACAACATTGGCGTCTTGCTG
CAAGGCGCGGCATTCATGTACAACTTTACGGAGGGTGACAGGAAATGGGCCGACCGCGTGGACAAGTTGACAGAG
CGAATCCTTGCCGACTTCTTCCCCAAAAAAATCGCGTTCGAGGTGCCCTGCGAGGTCCGTAAGGGCGCGTGCTCG
CCCGATATGCTCTCCTTCAAGGGCTACGTCCATCGCTGGCTGTCGGTCGTCACGCAGGTCGCGCCCTTTACCCGC
GACAAGATCCTCCCGGTGCTGCGCACCTCGACCGAGGCGGCCGTCAAGCAGTGCACGGGCGGGGAAACGGGCCGC
ATGTGCGGCTTCTACTGGAGCGAGGGCGTCTTCATCGACCCGGGCGTCGACCACACGTCGGGCGCAGGCGAGACC
ATGAACGTGCTGGCGGCCGTGTCGAGCCTGCTCATCGACGGGAACGGCGGCCCCGTCACCAACGCGACGGGCGGC
ATCTCCAAGGGGAACCCCAATGCCGGCGGAGGCCGCGACAACGGCGAGAGGGCGCCCCGCCCCATCACGGGCGGC
GACCGTGCCGGCGCCGGCATCCTGACCTTTTTGCTGCTCGGCAGCGCCGTCGGCACCTTTGTCTGGATGAGCTTG
TTCGAGTAA
Transcript >Hirsu2|266
ATGTTTCCCTCGTCACCTCCAAGCCTGTCCCGGGCATGGCCACTGGTTATGGCTGGAAGCCTGCTCTTGGGCGGC
ACTGGGGCCCAGGCACCGGGGCCGGCCTCGACATACAAGATCGATACTCCCGATAACATCCGCGAGTCGGCCAGC
ACCTTGGCCTACGACCTGATGCTCCTGTACCCGGGCAACAAGACGGGCGGCATCCCGGGCACCCTGCCTGGCCCG
CCCCCGGCCGGACCATACTACTGGTGGGAAGGCGGCGCCATGATGGGCACCTACATCGACTACTGGCACCTGACG
GGCGATTCCAGCTACAACAAGGTCGTCATGGAGGGCATGCTGCACCAGGTCGGCGACAAGGAGAACTACATGCCC
GCCAACCACACCATGTCGCTCGGCAACGACGATCAAGGCTTCTGGGGCATGTCCGCCATGCTGGCCGCCGAGAAC
AAGTTCCCTAATCCGCCCGACGATAAGCCCCAGTGGCTGGCCCTGGCCCAAGCCGTCTGGAATACCCAGGCTGAT
CCCAGCCGCCACGATACCACCTGCGGCGGCGGACTACGCTGGCAGATTCCCTTCGCCAACGCCGGATACAACTAC
AAGAACACCATCGCCAACGGGTGTTTCTTCAATATCGGGGCACGACTGGCGCGCTATACCAAGAACGCGACATAT
GCCGAATGGGCCGACAAGACGTGGGACTGGCTCTGGGGCGTTCACTTCATCGACCACGAGTCGTGGCGCGTCTAC
GACGGCGCCCACGTCGAGGCAAACTGCACCGACATCAACAAGGCCACCTTCTCCTACAACATTGGCGTCTTGCTG
CAAGGCGCGGCATTCATGTACAACTTTACGGAGGGTGACAGGAAATGGGCCGACCGCGTGGACAAGTTGACAGAG
CGAATCCTTGCCGACTTCTTCCCCAAAAAAATCGCGTTCGAGGTGCCCTGCGAGGTCCGTAAGGGCGCGTGCTCG
CCCGATATGCTCTCCTTCAAGGGCTACGTCCATCGCTGGCTGTCGGTCGTCACGCAGGTCGCGCCCTTTACCCGC
GACAAGATCCTCCCGGTGCTGCGCACCTCGACCGAGGCGGCCGTCAAGCAGTGCACGGGCGGGGAAACGGGCCGC
ATGTGCGGCTTCTACTGGAGCGAGGGCGTCTTCATCGACCCGGGCGTCGACCACACGTCGGGCGCAGGCGAGACC
ATGAACGTGCTGGCGGCCGTGTCGAGCCTGCTCATCGACGGGAACGGCGGCCCCGTCACCAACGCGACGGGCGGC
ATCTCCAAGGGGAACCCCAATGCCGGCGGAGGCCGCGACAACGGCGAGAGGGCGCCCCGCCCCATCACGGGCGGC
GACCGTGCCGGCGCCGGCATCCTGACCTTTTTGCTGCTCGGCAGCGCCGTCGGCACCTTTGTCTGGATGAGCTTG
TTCGAGTAA
Gene >Hirsu2|266
ATGTTTCCCTCGTCACCTCCAAGCCTGTCCCGGGCATGGCCACTGGTTATGGCTGGAAGCCTGCTCTTGGGCGGC
ACTGGGGCCCAGGCACCGGGGCCGGCCTCGACATACAAGATCGATACTCCCGGTACGAGCCTCCCTTTCCCGTCT
TGCGCCACTCGCTTCTCTTTCTCTCTCCTCCTCTTCCGTAGACCCGAGAAGCAGAGACAGGCCGACTAACTCACC
CTGCGCGGCGCCCGGAACAGATAACATCCGCGAGTCGGCCAGCACCTTGGCCTACGACCTGATGCTCCTGTACCC
GGGCAACAAGACGGGCGGCATCCCGGGCACCCTGCCTGGCCCGCCCCCGGCCGGACCATACTACTGGTGGGAAGG
CGGCGCCATGATGGGCACCTACATCGACTACTGGCACCTGACGGGCGATTCCAGCTACAACAAGGTCGTCATGGA
GGGCATGCTGCACCAGGTCGGCGACAAGGAGAACTACATGCCCGCCAACCACACCATGTCGCTCGGCAACGACGA
TCAAGGCTTCTGGGGCATGTCCGCCATGCTGGCCGCCGAGAACAAGTTCCCTAATCCGCCCGACGATAAGCCCCA
GTGGCTGGCCCTGGCCCAAGCCGTCTGGAATACCCAGGCTGATCCCAGCCGCCACGATACCACCTGCGGCGGCGG
ACTACGCTGGCAGATTCCCTTCGCCAACGCCGGATACAACTACAAGAACAGTATGCCGCTGCCAGTTTAAGCCCT
ACCCCCCTTTCTCGCTGCTCGCGGCTCTGGGCGTTCCTCCAACGTCGCCCATGACGGCTAACACGCGCGTCCCCT
TCCTCCTCTAGCCATCGCCAACGGGTGTTTCTTCAATATCGGGGCACGACTGGCGCGCTATACCAAGAACGCGAC
ATATGCCGAATGGGCCGACAAGACGTGGGACTGGCTCTGGGGCGTTCACTTCATCGACCACGAGTCGTGGCGCGT
CTACGACGGCGCCCACGTCGAGGCAAACTGCACCGACATCAACAAGGCCACCTTCTCCTACAACATTGGCGTCTT
GCTGCAAGGCGCGGCATTCATGTACAACTTTGTAAGTCTCGCTCTCTGCGCCCCCTGGCCACGGCTTCAACAAGA
CCACGCCAGCGACCCAAAGTTTTCGCGGCCATACCGCTGACAACTTGGATCCGCCACAGACGGAGGGTGACAGGA
AATGGGCCGACCGCGTGGACAAGTTGACAGAGCGAATCCTTGCCGACTTCTTCCCCAAAAAAATCGCGTTCGAGG
TGCCCTGCGAGGTCCGTAAGGGCGCGTGCTCGCCCGATATGCTCTCCTTCAAGGGCTACGTCCATCGCTGGCTGT
CGGTCGTCACGCAGGTCGCGCCCTTTACCCGCGACAAGATCCTCCCGGTGCTGCGCACCTCGACCGAGGCGGCCG
TCAAGCAGTGCACGGGCGGGGAAACGGGCCGCATGTGCGGCTTCTACTGGAGCGAGGGCGTCTTCATCGACCCGG
GCGTCGACCACACGTCGGGCGCAGGCGAGACCATGAACGTGCTGGCGGCCGTGTCGAGCCTGCTCATCGACGGGA
ACGGCGGCCCCGTCACCAACGCGACGGGCGGCATCTCCAAGGGGAACCCCAATGCCGGCGGAGGCCGCGACAACG
GCGAGAGGGCGCCCCGCCCCATCACGGGCGGCGACCGTGCCGGCGCCGGCATCCTGACCTTTTTGCTGCTCGGCA
GCGCCGTCGGCACCTTTGTCTGGATGAGCTTGTTCGAGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail