Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2656
Gene name
LocationContig_1641:3764..4610
Strand-
Gene length (bp)846
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain 6.1E-09 103 171
PF00043 GST_C Glutathione S-transferase, C-terminal domain 2.1E-08 107 169
PF02798 GST_N Glutathione S-transferase, N-terminal domain 1.5E-07 3 46
PF13410 GST_C_2 Glutathione S-transferase, C-terminal domain 3.1E-07 102 163
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 1.6E-06 5 51
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 4.7E-06 4 45

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q46845|YGHU_ECOLI Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) GN=yghU PE=1 SV=2 3 193 1.0E-32
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 11 170 2.0E-32
sp|Q8SSU2|Y4223_DICDI Glutathione S-transferase domain-containing protein DDB_G0274223 OS=Dictyostelium discoideum GN=DDB_G0274223 PE=3 SV=1 11 185 1.0E-28
sp|Q8DTN7|Y1296_STRMU Uncharacterized GST-like protein SMU_1296 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_1296 PE=3 SV=1 1 177 3.0E-28
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 4 173 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q46845|YGHU_ECOLI Disulfide-bond oxidoreductase YghU OS=Escherichia coli (strain K12) GN=yghU PE=1 SV=2 3 193 1.0E-32
sp|P77526|YFCG_ECOLI Disulfide-bond oxidoreductase YfcG OS=Escherichia coli (strain K12) GN=yfcG PE=1 SV=1 11 170 2.0E-32
sp|Q8SSU2|Y4223_DICDI Glutathione S-transferase domain-containing protein DDB_G0274223 OS=Dictyostelium discoideum GN=DDB_G0274223 PE=3 SV=1 11 185 1.0E-28
sp|Q8DTN7|Y1296_STRMU Uncharacterized GST-like protein SMU_1296 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_1296 PE=3 SV=1 1 177 3.0E-28
sp|Q9Y7Q2|GST1_SCHPO Glutathione S-transferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst1 PE=2 SV=1 4 173 3.0E-27
sp|Q54UR0|Y0881_DICDI Glutathione S-transferase domain-containing protein DDB_G0280881 OS=Dictyostelium discoideum GN=DDB_G0280881 PE=3 SV=1 11 184 1.0E-26
sp|A5DDU4|URE2_PICGU Protein URE2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=URE2 PE=3 SV=2 5 170 1.0E-25
sp|Q8NJR6|URE2_SACBA Protein URE2 OS=Saccharomyces bayanus GN=URE2 PE=3 SV=1 5 170 1.0E-25
sp|P23202|URE2_YEAST Transcriptional regulator URE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URE2 PE=1 SV=1 5 170 1.0E-25
sp|Q7LLZ8|URE2_SACPA Protein URE2 OS=Saccharomyces paradoxus GN=URE2 PE=3 SV=1 5 170 1.0E-25
sp|Q8NJR5|URE2_CANGA Protein URE2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URE2 PE=3 SV=2 5 170 2.0E-25
sp|Q96WL3|URE2_CANAL Protein URE2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=URE2 PE=3 SV=1 3 170 2.0E-25
sp|Q555N6|Y4705_DICDI Glutathione S-transferase domain-containing protein DDB_G0274705 OS=Dictyostelium discoideum GN=DDB_G0274705 PE=3 SV=3 11 185 3.0E-25
sp|Q6BM74|URE2_DEBHA Protein URE2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=URE2 PE=3 SV=2 3 170 3.0E-25
sp|Q8NJR4|URE2_KLUMA Protein URE2 OS=Kluyveromyces marxianus GN=URE2 PE=3 SV=1 5 170 7.0E-25
sp|Q8NJR0|URE2_CANMA Protein URE2 OS=Candida maltosa GN=URE2 PE=3 SV=1 3 170 2.0E-24
sp|Q8NJR2|URE2_ASHGO Protein URE2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URE2 PE=3 SV=1 5 170 3.0E-24
sp|Q96X43|URE2_KLULA Protein URE2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=URE2 PE=3 SV=1 5 170 1.0E-23
sp|O59827|GST2_SCHPO Glutathione S-transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gst2 PE=2 SV=1 5 173 3.0E-22
sp|Q93112|GST1C_ANOGA Glutathione S-transferase 1, isoform C OS=Anopheles gambiae GN=GstD1 PE=1 SV=2 1 170 1.0E-10
sp|Q9VG97|GSTD3_DROME Inactive glutathione S-transferase D3 OS=Drosophila melanogaster GN=GstD3 PE=2 SV=1 2 161 2.0E-10
sp|Q9VG94|GSTD6_DROME Glutathione S-transferase D6 OS=Drosophila melanogaster GN=GstD6 PE=1 SV=1 5 161 2.0E-10
sp|Q9VG93|GSTD7_DROME Glutathione S-transferase D7 OS=Drosophila melanogaster GN=GstD7 PE=1 SV=1 2 198 4.0E-10
sp|P0ACA9|GSTB_SHIFL Glutathione S-transferase GstB OS=Shigella flexneri GN=gstB PE=3 SV=1 11 178 2.0E-09
sp|P0ACA7|GSTB_ECOLI Glutathione S-transferase GstB OS=Escherichia coli (strain K12) GN=gstB PE=1 SV=1 11 178 2.0E-09
sp|P0ACA8|GSTB_ECOL6 Glutathione S-transferase GstB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gstB PE=3 SV=1 11 178 2.0E-09
sp|Q9SLM6|GSTF3_ARATH Glutathione S-transferase F3 OS=Arabidopsis thaliana GN=GSTF3 PE=2 SV=1 1 172 3.0E-09
sp|Q93113|GST1D_ANOGA Glutathione S-transferase 1, isoform D OS=Anopheles gambiae GN=GstD1 PE=1 SV=1 1 171 1.0E-08
sp|Q6R4B4|GST_ALTAL Glutathione-S-transferase OS=Alternaria alternata PE=1 SV=1 10 126 1.0E-08
sp|Q9ZVQ4|GSTZ2_ARATH Glutathione S-transferase Z2 OS=Arabidopsis thaliana GN=GSTZ2 PE=3 SV=1 1 179 1.0E-08
sp|Q9VG95|GSTD5_DROME Glutathione S-transferase D5 OS=Drosophila melanogaster GN=GstD5 PE=1 SV=2 2 163 3.0E-08
sp|Q52828|GSTA_RHILE Protein GstA OS=Rhizobium leguminosarum GN=gstA PE=3 SV=1 11 175 3.0E-08
sp|Q94999|GSTT2_ANOGA Glutathione S-transferase 2 OS=Anopheles gambiae GN=GstD2 PE=3 SV=2 1 174 1.0E-07
sp|P46431|GSTT2_MUSDO Glutathione S-transferase 2 OS=Musca domestica GN=Gst2 PE=2 SV=2 1 161 5.0E-07
sp|P46432|GSTT3_MUSDO Glutathione S-transferase 3 OS=Musca domestica GN=Gst3 PE=2 SV=1 1 161 9.0E-07
sp|Q96266|GSTF8_ARATH Glutathione S-transferase F8, chloroplastic OS=Arabidopsis thaliana GN=GSTF8 PE=1 SV=3 1 170 2.0E-06
sp|P46433|GSTT4_MUSDO Glutathione S-transferase 4 OS=Musca domestica GN=Gst4 PE=2 SV=1 11 170 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2656
MMDNEQKQAWFLDINPNGRIPALTDELPDGRPIRVFESGAILQYLVDRYDTQHKISYPKDSPEHWEVTSWLMWQM
GGLGPMQGQANHFKRYAPEKIEYGINRYTNESRRLYRTMDAHLAKSASGFLVGDRVTIADISCWGWIAAHDWAGI
GLDEFPHLERWLAKLLERPGFEAGRHVPEPHRAFDKLTEEERDRKAEAARGWVQSGMKADAKV*
Coding >Hirsu2|2656
ATGATGGACAACGAGCAGAAGCAGGCCTGGTTCCTCGACATCAACCCCAACGGCCGCATCCCCGCCCTGACGGAC
GAGCTGCCCGACGGCCGGCCCATCCGCGTCTTCGAGAGCGGCGCGATCCTGCAGTACCTGGTCGACCGGTACGAC
ACGCAGCACAAGATATCGTACCCCAAGGACTCGCCCGAGCACTGGGAGGTGACGAGCTGGTTGATGTGGCAGATG
GGCGGCCTGGGCCCGATGCAGGGCCAGGCGAACCACTTCAAGAGATACGCCCCGGAGAAGATCGAGTACGGCATC
AACCGGTACACCAACGAGAGCCGCCGCCTGTACCGCACCATGGACGCGCACCTGGCCAAGTCGGCGTCCGGCTTC
CTGGTCGGCGACCGCGTCACCATCGCCGACATCTCGTGCTGGGGCTGGATCGCGGCCCACGACTGGGCAGGCATC
GGCCTCGACGAGTTCCCACACCTCGAGCGCTGGCTGGCCAAGCTCCTGGAGCGGCCCGGCTTCGAGGCGGGCCGG
CACGTGCCCGAGCCGCACCGGGCCTTCGACAAGCTGACGGAGGAGGAGCGGGACCGCAAGGCCGAGGCCGCGCGC
GGCTGGGTCCAGAGCGGGATGAAGGCCGACGCCAAGGTGTAG
Transcript >Hirsu2|2656
ATGATGGACAACGAGCAGAAGCAGGCCTGGTTCCTCGACATCAACCCCAACGGCCGCATCCCCGCCCTGACGGAC
GAGCTGCCCGACGGCCGGCCCATCCGCGTCTTCGAGAGCGGCGCGATCCTGCAGTACCTGGTCGACCGGTACGAC
ACGCAGCACAAGATATCGTACCCCAAGGACTCGCCCGAGCACTGGGAGGTGACGAGCTGGTTGATGTGGCAGATG
GGCGGCCTGGGCCCGATGCAGGGCCAGGCGAACCACTTCAAGAGATACGCCCCGGAGAAGATCGAGTACGGCATC
AACCGGTACACCAACGAGAGCCGCCGCCTGTACCGCACCATGGACGCGCACCTGGCCAAGTCGGCGTCCGGCTTC
CTGGTCGGCGACCGCGTCACCATCGCCGACATCTCGTGCTGGGGCTGGATCGCGGCCCACGACTGGGCAGGCATC
GGCCTCGACGAGTTCCCACACCTCGAGCGCTGGCTGGCCAAGCTCCTGGAGCGGCCCGGCTTCGAGGCGGGCCGG
CACGTGCCCGAGCCGCACCGGGCCTTCGACAAGCTGACGGAGGAGGAGCGGGACCGCAAGGCCGAGGCCGCGCGC
GGCTGGGTCCAGAGCGGGATGAAGGCCGACGCCAAGGTGTAG
Gene >Hirsu2|2656
ATGATGGACAACGAGCAGAAGCAGGCCTGGTTCCTCGACATCAACCCCAACGGCCGCATCCCCGCCCTGACGGAC
GAGCTGCCCGACGGCCGGCCCATCCGCGTCTTCGAGAGCGGCGCGATCCTGCAGTACCTGGTCGACCGGTACGAC
ACGCAGCACAAGATATCGTACCCCAAGGACTCGCCCGAGCACTGGGAGGTGACGAGCTGGGTTGGGCCGCCCCCC
CATCCCTTCTTGACGACGGGAGCTGACCAGCACCAAGTTGATGTGGCAGATGGGCGGCCTGGGCCCGATGCAGGG
CCAGGCGAACCACTTCAAGAGTGAGCAGCAGGAACAGGAGAAGAAGACAAGCTAGTCTCGCAACCCGCCCGGAAC
TAACGAGCCCGCGCGCATGGCAGGATACGCCCCGGAGAAGATCGAGTACGGCATCAACCGGTACACCAACGAGAG
CCGCCGCCTGTACCGCACCATGGACGCGCACCTGGCCAAGTCGGCGTCCGGCTTCCTGGTCGGCGACCGCGTCAC
CATCGCCGACATCTCGTGCTGGGGCTGGATCGCGGCCCACGGTGAGTCTTGACGAAAAAAAAAAGACCTGAGCTT
CCGTCCCTCCGCCCGCTCTGACACGCGCGCACACATACAGACTGGGCAGGCATCGGCCTCGACGAGTTCCCACAC
CTCGAGCGCTGGCTGGCCAAGCTCCTGGAGCGGCCCGGCTTCGAGGCGGGCCGGCACGTGCCCGAGCCGCACCGG
GCCTTCGACAAGCTGACGGAGGAGGAGCGGGACCGCAAGGCCGAGGCCGCGCGCGGCTGGGTCCAGAGCGGGATG
AAGGCCGACGCCAAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail