Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2648
Gene name
LocationContig_164:15432..16518
Strand-
Gene length (bp)1086
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 4.1E-28 112 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 90 310 4.0E-31
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 90 310 5.0E-31
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 87 282 4.0E-27
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 90 281 1.0E-26
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 90 281 1.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 90 310 4.0E-31
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 90 310 5.0E-31
sp|P11543|LIG5_PHACH Ligninase LG5 OS=Phanerochaete chrysosporium GN=GLG5 PE=2 SV=1 87 282 4.0E-27
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 90 281 1.0E-26
sp|Q70LM3|PEM2_PHLRA Manganese peroxidase 2 OS=Phlebia radiata GN=mnp2 PE=1 SV=1 90 281 1.0E-25
sp|P49012|LIG2_PHACH Ligninase LG2 OS=Phanerochaete chrysosporium GN=GLG2 PE=1 SV=1 89 314 1.0E-25
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 90 281 2.0E-25
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 90 281 1.0E-23
sp|P06181|LIG8_PHACH Ligninase H8 OS=Phanerochaete chrysosporium GN=LPOA PE=1 SV=1 89 282 7.0E-23
sp|P31837|LIGA_PHACH Ligninase A OS=Phanerochaete chrysosporium GN=LIPA PE=3 SV=1 89 282 1.0E-22
sp|P20013|LIGC_TRAVE Ligninase C OS=Trametes versicolor PE=1 SV=2 90 282 2.0E-22
sp|P20010|LIG_PHLRA Ligninase-3 OS=Phlebia radiata PE=3 SV=1 81 282 4.0E-22
sp|P31838|LIGB_PHACH Ligninase B OS=Phanerochaete chrysosporium GN=LIPB PE=3 SV=1 89 282 6.0E-22
sp|P11542|LIG4_PHACH Ligninase H2 OS=Phanerochaete chrysosporium GN=GLG4 PE=1 SV=2 90 282 1.0E-21
sp|Q96TS6|PEM3_PHLRA Manganese peroxidase 3 OS=Phlebia radiata GN=mnp3 PE=2 SV=1 90 312 2.0E-21
sp|Q9UVP6|VPS1_PLEER Versatile peroxidase VPS1 OS=Pleurotus eryngii GN=vps1 PE=1 SV=1 88 278 3.0E-21
sp|P50622|LIG6_PHACH Ligninase LG6 OS=Phanerochaete chrysosporium GN=GLG6 PE=2 SV=1 89 312 5.0E-21
sp|P28314|PER_COPCI Peroxidase OS=Coprinopsis cinerea GN=CIP1 PE=1 SV=2 90 278 2.0E-20
sp|P28313|PER_ARTRA Peroxidase OS=Arthromyces ramosus PE=1 SV=3 90 278 3.0E-20
sp|A8NK72|PER_COPC7 Peroxidase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CIP1 PE=3 SV=1 90 278 6.0E-20
sp|P21764|LIG3_PHACH Ligninase LG3 OS=Phanerochaete chrysosporium GN=GLG3 PE=2 SV=1 89 282 9.0E-20
sp|C0IW58|LNP_TAICA Low-redox potential peroxidase OS=Taiwanofungus camphoratus GN=LnP PE=1 SV=1 153 312 7.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 119 259 7.0E-14
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 119 313 1.0E-12
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 115 250 1.0E-12
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 119 313 2.0E-12
sp|Q42593|APXT_ARATH L-ascorbate peroxidase T, chloroplastic OS=Arabidopsis thaliana GN=APXT PE=2 SV=2 82 263 1.0E-11
sp|Q9FE01|APX2_ORYSJ L-ascorbate peroxidase 2, cytosolic OS=Oryza sativa subsp. japonica GN=APX2 PE=1 SV=1 119 306 3.0E-11
sp|Q42592|APXS_ARATH L-ascorbate peroxidase S, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=APXS PE=1 SV=2 94 263 6.0E-11
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 119 313 7.0E-11
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 119 313 1.0E-10
sp|P0C0L0|APX5_ORYSJ Probable L-ascorbate peroxidase 5, chloroplastic OS=Oryza sativa subsp. japonica GN=APX5 PE=2 SV=1 119 263 1.0E-10
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 118 299 2.0E-10
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 119 306 3.0E-10
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 118 278 4.0E-10
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 119 303 5.0E-10
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 117 250 5.0E-10
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 85 249 6.0E-10
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 118 253 2.0E-09
sp|Q4PBY6|CCPR_USTMA Cytochrome c peroxidase, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP1 PE=3 SV=1 78 249 4.0E-09
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 119 250 4.0E-09
sp|Q7SDV9|CCPR_NEUCR Cytochrome c peroxidase, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ccp-1 PE=3 SV=1 75 249 6.0E-09
sp|A4QVH4|CCPR_MAGO7 Cytochrome c peroxidase, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CCP1 PE=3 SV=1 119 249 3.0E-08
sp|Q6BKY9|CCPR_DEBHA Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCP1 PE=3 SV=1 58 249 5.0E-08
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 118 278 1.0E-07
sp|Q4ING3|CCPR_GIBZE Cytochrome c peroxidase, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CCP1 PE=3 SV=1 119 249 1.0E-07
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 75 299 2.0E-07
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 118 278 3.0E-07
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 118 250 3.0E-07
sp|Q6URB0|CCPR_CRYNH Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CCP1 PE=3 SV=1 114 282 4.0E-07
sp|Q4WLG9|CCPR2_ASPFU Putative heme-binding peroxidase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G13570 PE=3 SV=1 119 250 6.0E-07
sp|Q4PD66|CCPR2_USTMA Putative heme-binding peroxidase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCP2 PE=3 SV=1 118 250 9.0E-07
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 114 249 1.0E-06
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 114 249 1.0E-06
sp|Q1PER6|APX2_ARATH L-ascorbate peroxidase 2, cytosolic OS=Arabidopsis thaliana GN=APX2 PE=2 SV=3 118 303 3.0E-06
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 114 278 3.0E-06
sp|Q4HWQ2|CCPR2_GIBZE Putative heme-binding peroxidase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_10606 PE=3 SV=1 80 250 3.0E-06
sp|P11965|PERX_TOBAC Lignin-forming anionic peroxidase OS=Nicotiana tabacum PE=2 SV=1 117 265 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0004601 peroxidase activity Yes
GO:0006950 response to stress No
GO:0016491 oxidoreductase activity No
GO:0046906 tetrapyrrole binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0050896 response to stimulus No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1068 0.0587 0.9433 0.1254 0.1052 0.024 0.1409 0.1451 0.0854 0.0131

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
AA2 3.5E-54 93 284

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup72
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7755
Ophiocordyceps australis map64 (Brazil) OphauB2|5788
Ophiocordyceps camponoti-floridani Ophcf2|03380
Ophiocordyceps camponoti-floridani Ophcf2|05952
Ophiocordyceps camponoti-floridani Ophcf2|06949
Ophiocordyceps camponoti-rufipedis Ophun1|2842
Ophiocordyceps camponoti-rufipedis Ophun1|490
Ophiocordyceps camponoti-rufipedis Ophun1|576
Ophiocordyceps kimflemingae Ophio5|1136
Ophiocordyceps kimflemingae Ophio5|3516
Ophiocordyceps kimflemingae Ophio5|4077
Ophiocordyceps kimflemingae Ophio5|6981
Ophiocordyceps subramaniannii Hirsu2|2648 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7177
Ophiocordyceps subramaniannii Hirsu2|7933
Ophiocordyceps subramaniannii Hirsu2|9306

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2648
MKTAALVLFAGRLAYGFAGLRDLKARAAVLEGRGTNELIGDLATLRDDQLTPTGRSIKSLLTGGGIPEELIDHYI
FTPAIDSPQCKADTCCIWKHIADDMKSMMVGSAGRCNDLARQCVRLGFHDAGSWSKSTGRGGGADGSMVLTNECF
DRPINRGLETACTQLAVWHDKYKQYGVSMADLIQFAANVATVTCPLGPRVRTYVGRKDNPTPSPDGLIPDPFQSA
DQLISLFLDKTISPDELVALVGAHTTAQQRFVDPARAGDPLDSTPGVWDVRFYGQVRSSFTPRRVFKFPSDVSLS
RHPDTRGTWNLFSGLITGQIPWNLVRNNRLGPPRPFWFKG*
Coding >Hirsu2|2648
ATGAAGACGGCGGCGCTCGTTCTATTCGCCGGCAGGCTGGCCTACGGCTTCGCCGGCTTGCGAGACCTGAAAGCA
CGCGCTGCCGTGCTGGAGGGAAGAGGCACCAACGAGCTTATAGGAGACCTGGCCACCCTCCGAGATGATCAGCTC
ACACCGACGGGCAGGAGTATCAAGTCGCTCCTCACCGGGGGCGGGATCCCCGAGGAGCTCATAGATCATTACATC
TTTACGCCGGCGATAGACTCGCCACAGTGCAAGGCCGACACGTGCTGCATCTGGAAGCACATAGCGGATGACATG
AAGTCGATGATGGTGGGCTCCGCCGGCCGCTGCAACGACCTCGCCCGCCAGTGCGTCCGCCTCGGCTTCCACGAC
GCGGGCAGCTGGTCCAAGAGCACGGGCAGGGGCGGCGGAGCGGACGGCTCCATGGTGCTGACGAACGAGTGCTTC
GACCGTCCCATCAACAGGGGCCTCGAGACGGCCTGCACCCAGCTCGCCGTCTGGCACGACAAGTACAAGCAGTAC
GGCGTCAGCATGGCCGACTTGATCCAGTTCGCCGCCAACGTGGCAACGGTGACTTGTCCCCTGGGTCCCCGTGTC
CGCACCTATGTCGGCCGCAAGGACAATCCGACCCCGTCTCCGGACGGCCTTATCCCGGATCCGTTCCAGAGCGCC
GACCAGCTCATCAGCCTCTTTCTCGACAAGACCATCAGCCCCGACGAGCTCGTCGCCCTTGTCGGCGCCCACACG
ACGGCCCAGCAGCGGTTCGTCGATCCGGCCCGCGCCGGCGACCCACTCGACAGCACGCCGGGCGTCTGGGACGTC
CGCTTTTACGGCCAGGTCCGGAGCTCCTTCACGCCGCGCCGGGTCTTCAAGTTCCCGAGTGACGTCAGTCTGTCC
AGGCACCCGGACACCCGCGGTACCTGGAACCTCTTCTCCGGCCTGATCACCGGCCAGATCCCTTGGAACCTGGTA
AGGAATAACCGGCTCGGCCCCCCCCGCCCCTTCTGGTTCAAGGGCTGA
Transcript >Hirsu2|2648
ATGAAGACGGCGGCGCTCGTTCTATTCGCCGGCAGGCTGGCCTACGGCTTCGCCGGCTTGCGAGACCTGAAAGCA
CGCGCTGCCGTGCTGGAGGGAAGAGGCACCAACGAGCTTATAGGAGACCTGGCCACCCTCCGAGATGATCAGCTC
ACACCGACGGGCAGGAGTATCAAGTCGCTCCTCACCGGGGGCGGGATCCCCGAGGAGCTCATAGATCATTACATC
TTTACGCCGGCGATAGACTCGCCACAGTGCAAGGCCGACACGTGCTGCATCTGGAAGCACATAGCGGATGACATG
AAGTCGATGATGGTGGGCTCCGCCGGCCGCTGCAACGACCTCGCCCGCCAGTGCGTCCGCCTCGGCTTCCACGAC
GCGGGCAGCTGGTCCAAGAGCACGGGCAGGGGCGGCGGAGCGGACGGCTCCATGGTGCTGACGAACGAGTGCTTC
GACCGTCCCATCAACAGGGGCCTCGAGACGGCCTGCACCCAGCTCGCCGTCTGGCACGACAAGTACAAGCAGTAC
GGCGTCAGCATGGCCGACTTGATCCAGTTCGCCGCCAACGTGGCAACGGTGACTTGTCCCCTGGGTCCCCGTGTC
CGCACCTATGTCGGCCGCAAGGACAATCCGACCCCGTCTCCGGACGGCCTTATCCCGGATCCGTTCCAGAGCGCC
GACCAGCTCATCAGCCTCTTTCTCGACAAGACCATCAGCCCCGACGAGCTCGTCGCCCTTGTCGGCGCCCACACG
ACGGCCCAGCAGCGGTTCGTCGATCCGGCCCGCGCCGGCGACCCACTCGACAGCACGCCGGGCGTCTGGGACGTC
CGCTTTTACGGCCAGGTCCGGAGCTCCTTCACGCCGCGCCGGGTCTTCAAGTTCCCGAGTGACGTCAGTCTGTCC
AGGCACCCGGACACCCGCGGTACCTGGAACCTCTTCTCCGGCCTGATCACCGGCCAGATCCCTTGGAACCTGGTA
AGGAATAACCGGCTCGGCCCCCCCCGCCCCTTCTGGTTCAAGGGCTGA
Gene >Hirsu2|2648
ATGAAGACGGCGGCGCTCGTTCTATTCGCCGGCAGGCTGGCCTACGGCTTCGCCGGCTTGCGAGACCTGAAAGCA
CGCGCTGCCGTGCTGGAGGGAAGAGGCACCAACGAGCTTATAGGAGACCTGGCCACCCTCCGAGATGATCAGCTC
ACACCGACGGGCAGGAGTATCAAGTCGCTCCTCACCGGGGGCGGGATCCCCGAGGAGCTCATAGATCATTACATC
TTTACGCCGGCGATAGACTCGCCACAGTGCAAGGCCGACACGTGCTGCATCTGGAAGCACATAGCGGATGACATG
AAGTCGATGATGGTGGGCTCCGCCGGCCGCTGCAACGACCTCGCCCGCCAGTGCGTCCGCCTCGGCTTCCACGAC
GCGGGCAGCTGGTCCAAGAGCACGGGCAGGGGCGGCGGAGCGGACGGCTCCATGGTGCTGACGAACGAGTGCTTC
GACCGTCCCATCAACAGGGGCCTCGAGACGGCCTGCACCCAGCTCGCCGTCTGGCACGACAAGTACAAGCAGTAC
GGCGTCAGCATGGCCGACTTGATCCAGTTCGCCGGTGCGTACCTAAGCCCTGTGGGGAAGCCTCGGATAGTTGAA
AGATGGCTAACATGGATGAAAGCCAACGTGGCAACGGTGACTTGTCCCCTGGGTCCCCGTGTCCGCACCTATGTC
GGCCGCAAGGACAATCCGACCCCGTCTCCGGACGGCCTTATCCCGGATCCGTTCCAGAGCGCCGACCAGCTCATC
AGCCTCTTTCTCGACAAGACCATCAGCCCCGACGAGCTCGTCGCCCTTGTCGGCGCCCACACGACGGCCCAGCAG
CGGTTCGTCGATCCGGCCCGCGCCGGCGACCCACTCGACAGCACGCCGGGCGTCTGGGACGTCCGCTTTTACGGC
CAGGTCCGGAGCTCCTTCACGCCGCGCCGGGTCTTCAAGTTCCCGAGTGACGTCAGTCTGTCCAGGCACCCGGAC
ACCCGCGGTACCTGGAACCTCTTCTCCGGCCTGATCACCGGCCAGATCCCTTGGAACCTGGTAAGGAATAACCGG
CTCGGCCCCCCCCGCCCCTTCTGGTTCAAGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail