Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2643
Gene name
LocationContig_164:3286..4831
Strand+
Gene length (bp)1545
Transcript length (bp)1449
Coding sequence length (bp)1449
Protein length (aa) 483

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 6.8E-18 20 271

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 116 138 22
3 158 180 22
4 193 215 22
5 246 268 22
6 293 315 22
7 320 342 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2643
MAWGELKADGQSLSPLTPDLRRGLIAITVLALVSFATSTILFLYLTYKLVVWRFLVPPEQKQQQGELERRPSHAT
SDFRLGIDGIFTDGDPSRLDVAVSRQEDRRRRSKTPPPNQFLVLIYNLLLADMHQSLAFLLNASWLRADGIMART
PTCFVQGMLVSTGDLSSSMFISTIAVHTYLSVVRNCRPSHRTFFAVILGNWAFVYAISLLPVAVTRNGAERGGFF
VRAGAWCWMNRDYEQLRLATHYFFIFLALGVTSALYVGIFVSLRRQRALARRCVIAASQPLPRHEPAFLIYPLIY
VMCTLPLALGRIATMAGRQVPLGYFCFAGAIIAFNGSFDCLLFGTTRNAIIFGSPSDLSADDTGLKTFGFLKTPS
TRRYGNMIWIQGGGRRRRQEDKVAGGWCSWERLGNGRRHNTSPWPANGASSDTSQEFIRGAAIQMDMVTSVVVEM
NGEKNHRTLPPCSKALSATASETGTEMSSLKS*
Coding >Hirsu2|2643
ATGGCGTGGGGAGAGCTGAAGGCCGACGGTCAAAGTCTCAGCCCTCTGACGCCGGACCTGCGACGAGGACTGATC
GCCATCACCGTGCTGGCGCTCGTGTCCTTCGCCACCTCGACGATCCTGTTCCTCTACTTGACCTACAAGCTCGTC
GTCTGGCGCTTCCTCGTCCCGCCGGAGCAGAAGCAGCAGCAGGGCGAGCTCGAGCGCAGGCCGTCGCACGCGACC
TCGGACTTCAGGCTCGGCATCGATGGCATCTTCACCGACGGCGACCCGTCCCGGCTCGACGTGGCGGTGTCTCGG
CAGGAGGACAGGCGCCGACGGAGCAAGACTCCGCCGCCGAATCAGTTCCTCGTCCTCATCTACAACCTCCTCCTG
GCCGACATGCACCAGAGCCTGGCCTTCCTCCTCAACGCGTCATGGCTGCGAGCCGACGGCATCATGGCACGGACG
CCGACGTGCTTCGTGCAGGGCATGTTGGTCTCGACGGGCGACCTGTCGTCGAGCATGTTCATCAGCACCATCGCC
GTCCACACCTACCTCTCCGTCGTCCGGAACTGCCGGCCCTCTCACCGAACCTTTTTCGCCGTCATCCTCGGTAAC
TGGGCCTTCGTCTACGCCATATCCCTGCTGCCCGTGGCTGTGACGCGCAACGGCGCCGAGCGCGGTGGCTTCTTC
GTTCGCGCCGGCGCCTGGTGCTGGATGAATCGAGACTACGAGCAGCTTCGCCTCGCGACTCACTACTTCTTCATC
TTCCTCGCGTTGGGCGTCACGTCAGCGCTGTACGTCGGTATCTTTGTCTCTCTCCGCCGCCAACGGGCTCTGGCA
CGCCGATGCGTCATCGCCGCCAGCCAGCCGCTGCCGAGGCACGAGCCGGCCTTTCTCATCTACCCGCTCATCTAC
GTCATGTGCACCCTCCCCCTTGCCCTTGGCCGGATCGCCACCATGGCCGGCAGGCAGGTGCCGCTCGGATACTTT
TGTTTTGCCGGCGCCATCATCGCCTTCAACGGGTCCTTCGACTGCCTGCTGTTCGGCACGACGCGCAACGCCATC
ATCTTCGGCTCCCCGTCGGACCTCTCCGCCGACGACACGGGCCTGAAGACCTTTGGGTTCCTGAAGACGCCGTCG
ACGAGGCGCTACGGCAACATGATCTGGATCCAGGGCGGCGGGAGGAGGCGGAGGCAAGAGGACAAGGTCGCGGGC
GGCTGGTGCTCATGGGAGCGCCTGGGGAACGGGCGCCGGCACAACACGAGTCCCTGGCCTGCGAACGGCGCCTCG
TCGGATACGAGCCAGGAGTTCATCAGGGGGGCCGCGATCCAGATGGACATGGTGACGAGCGTTGTGGTGGAGATG
AACGGTGAAAAGAATCACCGCACACTGCCGCCCTGCAGCAAGGCTTTGAGTGCCACGGCGTCAGAGACGGGCACG
GAGATGTCGTCGTTGAAATCCTAG
Transcript >Hirsu2|2643
ATGGCGTGGGGAGAGCTGAAGGCCGACGGTCAAAGTCTCAGCCCTCTGACGCCGGACCTGCGACGAGGACTGATC
GCCATCACCGTGCTGGCGCTCGTGTCCTTCGCCACCTCGACGATCCTGTTCCTCTACTTGACCTACAAGCTCGTC
GTCTGGCGCTTCCTCGTCCCGCCGGAGCAGAAGCAGCAGCAGGGCGAGCTCGAGCGCAGGCCGTCGCACGCGACC
TCGGACTTCAGGCTCGGCATCGATGGCATCTTCACCGACGGCGACCCGTCCCGGCTCGACGTGGCGGTGTCTCGG
CAGGAGGACAGGCGCCGACGGAGCAAGACTCCGCCGCCGAATCAGTTCCTCGTCCTCATCTACAACCTCCTCCTG
GCCGACATGCACCAGAGCCTGGCCTTCCTCCTCAACGCGTCATGGCTGCGAGCCGACGGCATCATGGCACGGACG
CCGACGTGCTTCGTGCAGGGCATGTTGGTCTCGACGGGCGACCTGTCGTCGAGCATGTTCATCAGCACCATCGCC
GTCCACACCTACCTCTCCGTCGTCCGGAACTGCCGGCCCTCTCACCGAACCTTTTTCGCCGTCATCCTCGGTAAC
TGGGCCTTCGTCTACGCCATATCCCTGCTGCCCGTGGCTGTGACGCGCAACGGCGCCGAGCGCGGTGGCTTCTTC
GTTCGCGCCGGCGCCTGGTGCTGGATGAATCGAGACTACGAGCAGCTTCGCCTCGCGACTCACTACTTCTTCATC
TTCCTCGCGTTGGGCGTCACGTCAGCGCTGTACGTCGGTATCTTTGTCTCTCTCCGCCGCCAACGGGCTCTGGCA
CGCCGATGCGTCATCGCCGCCAGCCAGCCGCTGCCGAGGCACGAGCCGGCCTTTCTCATCTACCCGCTCATCTAC
GTCATGTGCACCCTCCCCCTTGCCCTTGGCCGGATCGCCACCATGGCCGGCAGGCAGGTGCCGCTCGGATACTTT
TGTTTTGCCGGCGCCATCATCGCCTTCAACGGGTCCTTCGACTGCCTGCTGTTCGGCACGACGCGCAACGCCATC
ATCTTCGGCTCCCCGTCGGACCTCTCCGCCGACGACACGGGCCTGAAGACCTTTGGGTTCCTGAAGACGCCGTCG
ACGAGGCGCTACGGCAACATGATCTGGATCCAGGGCGGCGGGAGGAGGCGGAGGCAAGAGGACAAGGTCGCGGGC
GGCTGGTGCTCATGGGAGCGCCTGGGGAACGGGCGCCGGCACAACACGAGTCCCTGGCCTGCGAACGGCGCCTCG
TCGGATACGAGCCAGGAGTTCATCAGGGGGGCCGCGATCCAGATGGACATGGTGACGAGCGTTGTGGTGGAGATG
AACGGTGAAAAGAATCACCGCACACTGCCGCCCTGCAGCAAGGCTTTGAGTGCCACGGCGTCAGAGACGGGCACG
GAGATGTCGTCGTTGAAATCCTAG
Gene >Hirsu2|2643
ATGGCGTGGGGAGAGCTGAAGGCCGACGGTCAAAGTCTCAGCCCTCTGACGCCGGACCTGCGACGAGGACTGATC
GCCATCACCGTGCTGGCGCTCGTGTCCTTCGCCACCTCGACGATCCTGTTCCTCTACTTGACCTACAAGCTCGTC
GTCTGGCGCTTCCTCGTCCCGCCGGAGCAGAAGCAGCAGCAGGGCGAGCTCGAGCGCAGGCCGTCGCACGCGACC
TCGGACTTCAGGCTCGGCATCGATGGCATCTTCACCGACGGCGACCCGTCCCGGCTCGACGTGGCGGTGTCTCGG
CAGGAGGACAGGCGCCGACGGAGCAAGACTCCGCCGCCGAATCAGTTCCTCGTCCTCATCTACAACCTCCTCCTG
GCCGACATGCACCAGAGCCTGGCCTTCCTCCTCAACGCGTCATGGCTGCGAGCCGACGGCATCATGGCACGGACG
CCGACGTGCTTCGTGCAGGGCATGTTGGTCTCGACGGGCGACCTGTCGTCGAGCATGTTCATCAGCACCATCGCC
GTCCACACCTACCTCTCCGTCGTCCGGAACTGCCGGCCCTCTCACCGAACCTTTTTCGCCGTCATCCTCGGTAAC
TGGGCCTTCGTCTACGCCATATCCCTGCTGCCCGTGGCTGTGACGCGCAACGGCGCCGAGCGCGGTGGCTTCTTC
GTTCGCGCCGGCGCCTGGGTACGTTGAGCCGATGAATCCGCCGAACCGAGCCGGCTGTTCTCGTCGAGGAAGCCT
TGCAGAGCTGACGCCAAGCCACCCCGGCTCCGTCTCTAGTGCTGGATGAATCGAGACTACGAGCAGCTTCGCCTC
GCGACTCACTACTTCTTCATCTTCCTCGCGTTGGGCGTCACGTCAGCGCTGTACGTCGGTATCTTTGTCTCTCTC
CGCCGCCAACGGGCTCTGGCACGCCGATGCGTCATCGCCGCCAGCCAGCCGCTGCCGAGGCACGAGCCGGCCTTT
CTCATCTACCCGCTCATCTACGTCATGTGCACCCTCCCCCTTGCCCTTGGCCGGATCGCCACCATGGCCGGCAGG
CAGGTGCCGCTCGGATACTTTTGTTTTGCCGGCGCCATCATCGCCTTCAACGGGTCCTTCGACTGCCTGCTGTTC
GGCACGACGCGCAACGCCATCATCTTCGGCTCCCCGTCGGACCTCTCCGCCGACGACACGGGCCTGAAGACCTTT
GGGTTCCTGAAGACGCCGTCGACGAGGCGCTACGGCAACATGATCTGGATCCAGGGCGGCGGGAGGAGGCGGAGG
CAAGAGGACAAGGTCGCGGGCGGCTGGTGCTCATGGGAGCGCCTGGGGAACGGGCGCCGGCACAACACGAGTCCC
TGGCCTGCGAACGGCGCCTCGTCGGATACGAGCCAGGAGTTCATCAGGGGGGCCGCGATCCAGATGGACATGGTG
ACGAGCGTTGTGGTGGAGATGAACGGTGAAAAGAATCACCGCACACTGCCGCCCTGCAGCAAGGCTTTGAGTGCC
ACGGCGTCAGAGACGGGCACGGAGATGTCGTCGTTGAAATCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail