Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2642
Gene name
LocationContig_164:220..1560
Strand+
Gene length (bp)1340
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01529 DHHC DHHC palmitoyltransferase 2.5E-25 143 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1J3|PFA5_GIBZE Palmitoyltransferase PFA5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA5 PE=3 SV=1 2 399 2.0E-129
sp|Q4WUK1|PFA5_ASPFU Palmitoyltransferase pfa5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa5 PE=3 SV=2 18 387 5.0E-72
sp|Q5B433|PFA5_EMENI Palmitoyltransferase pfa5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa5 PE=3 SV=2 18 404 4.0E-62
sp|Q6C7D1|PFA5_YARLI Palmitoyltransferase PFA5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA5 PE=3 SV=1 11 360 1.0E-26
sp|Q9C0W9|PFA5_SCHPO Palmitoyltransferase PFA5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa-5 PE=3 SV=1 127 364 4.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I1J3|PFA5_GIBZE Palmitoyltransferase PFA5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA5 PE=3 SV=1 2 399 2.0E-129
sp|Q4WUK1|PFA5_ASPFU Palmitoyltransferase pfa5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa5 PE=3 SV=2 18 387 5.0E-72
sp|Q5B433|PFA5_EMENI Palmitoyltransferase pfa5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa5 PE=3 SV=2 18 404 4.0E-62
sp|Q6C7D1|PFA5_YARLI Palmitoyltransferase PFA5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA5 PE=3 SV=1 11 360 1.0E-26
sp|Q9C0W9|PFA5_SCHPO Palmitoyltransferase PFA5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa-5 PE=3 SV=1 127 364 4.0E-24
sp|Q6CRV3|PFA5_KLULA Palmitoyltransferase PFA5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA5 PE=3 SV=1 33 262 6.0E-20
sp|Q03289|PFA5_YEAST Palmitoyltransferase PFA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA5 PE=1 SV=1 15 265 1.0E-19
sp|Q5ADN9|PFA3_CANAL Palmitoyltransferase PFA3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA3 PE=3 SV=1 145 378 2.0E-18
sp|Q5Y5T1|ZDH20_MOUSE Probable palmitoyltransferase ZDHHC20 OS=Mus musculus GN=Zdhhc20 PE=1 SV=1 23 253 4.0E-15
sp|Q6FMP5|PFA5_CANGA Palmitoyltransferase PFA5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA5 PE=3 SV=1 15 261 6.0E-15
sp|Q59NR8|PFA5_CANAL Palmitoyltransferase PFA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA5 PE=3 SV=1 134 351 7.0E-15
sp|Q6BP97|PFA5_DEBHA Palmitoyltransferase PFA5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA5 PE=3 SV=2 134 266 3.0E-14
sp|Q4IMZ7|PFA4_GIBZE Palmitoyltransferase PFA4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA4 PE=3 SV=1 137 364 5.0E-14
sp|Q6C4W5|PFA3_YARLI Palmitoyltransferase PFA3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA3 PE=3 SV=1 137 265 2.0E-13
sp|Q9SB58|ZDH19_ARATH Protein S-acyltransferase 8 OS=Arabidopsis thaliana GN=PAT08 PE=1 SV=2 28 340 3.0E-13
sp|Q4WC37|PFA4_ASPFU Palmitoyltransferase pfa4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa4 PE=3 SV=2 116 364 7.0E-13
sp|Q8R173|ZDHC3_MOUSE Palmitoyltransferase ZDHHC3 OS=Mus musculus GN=Zdhhc3 PE=1 SV=1 104 265 2.0E-12
sp|Q75D19|PFA5_ASHGO Palmitoyltransferase PFA5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA5 PE=3 SV=2 134 388 2.0E-12
sp|Q6FW70|PFA3_CANGA Palmitoyltransferase PFA3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA3 PE=3 SV=1 119 364 2.0E-12
sp|Q9NYG2|ZDHC3_HUMAN Palmitoyltransferase ZDHHC3 OS=Homo sapiens GN=ZDHHC3 PE=1 SV=2 104 265 3.0E-12
sp|Q96MV8|ZDH15_HUMAN Palmitoyltransferase ZDHHC15 OS=Homo sapiens GN=ZDHHC15 PE=2 SV=1 33 396 3.0E-12
sp|Q5PNZ1|ZDH21_ARATH Probable protein S-acyltransferase 3 OS=Arabidopsis thaliana GN=PAT03 PE=2 SV=1 20 262 3.0E-12
sp|Q2TGJ4|ZDH15_RAT Palmitoyltransferase ZDHHC15 OS=Rattus norvegicus GN=Zdhhc15 PE=2 SV=1 33 396 5.0E-12
sp|P59267|ZDHC2_MOUSE Palmitoyltransferase ZDHHC2 OS=Mus musculus GN=Zdhhc2 PE=2 SV=1 2 284 5.0E-12
sp|Q9UIJ5|ZDHC2_HUMAN Palmitoyltransferase ZDHHC2 OS=Homo sapiens GN=ZDHHC2 PE=2 SV=1 6 284 6.0E-12
sp|Q9JKR5|ZDHC2_RAT Palmitoyltransferase ZDHHC2 OS=Rattus norvegicus GN=Zdhhc2 PE=2 SV=1 23 284 7.0E-12
sp|Q6CQB5|ERFB_KLULA Palmitoyltransferase ERF2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERF2 PE=3 SV=1 23 212 1.0E-11
sp|Q9FLM3|ZDH23_ARATH Probable protein S-acyltransferase 6 OS=Arabidopsis thaliana GN=PAT06 PE=2 SV=1 55 305 1.0E-11
sp|Q6CPU8|PFA3_KLULA Palmitoyltransferase PFA3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA3 PE=3 SV=1 117 238 1.0E-11
sp|P42836|PFA3_YEAST Palmitoyltransferase PFA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA3 PE=1 SV=1 119 361 1.0E-11
sp|P59268|ZDHC9_MOUSE Palmitoyltransferase ZDHHC9 OS=Mus musculus GN=Zdhhc9 PE=2 SV=1 53 195 1.0E-11
sp|Q8BGJ0|ZDH15_MOUSE Palmitoyltransferase ZDHHC15 OS=Mus musculus GN=Zdhhc15 PE=1 SV=1 33 252 2.0E-11
sp|Q9Y397|ZDHC9_HUMAN Palmitoyltransferase ZDHHC9 OS=Homo sapiens GN=ZDHHC9 PE=1 SV=2 53 195 2.0E-11
sp|Q58DA8|ZDHC9_BOVIN Palmitoyltransferase ZDHHC9 OS=Bos taurus GN=ZDHHC9 PE=2 SV=1 53 195 2.0E-11
sp|Q5FC64|ZDHCS_CAEEL Palmitoyltransferase spe-10 OS=Caenorhabditis elegans GN=spe-10 PE=1 SV=1 13 215 3.0E-11
sp|Q5BD15|PFA4_EMENI Palmitoyltransferase pfa4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa4 PE=3 SV=1 140 218 4.0E-11
sp|C8VCL4|PFA3_EMENI Palmitoyltransferase pfa3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfa3 PE=3 SV=2 136 267 6.0E-11
sp|Q7S7C5|PFA3_NEUCR Palmitoyltransferase pfa3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-3 PE=3 SV=3 136 209 1.0E-10
sp|Q75AW7|PFA3_ASHGO Palmitoyltransferase PFA3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA3 PE=3 SV=2 85 245 1.0E-10
sp|Q7SCY6|PFA4_NEUCR Palmitoyltransferase pfa4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-4 PE=3 SV=1 143 360 2.0E-10
sp|Q4WZL8|PFA3_ASPFU Palmitoyltransferase pfa3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfa3 PE=3 SV=1 135 267 2.0E-10
sp|Q6BLY8|PFA4_DEBHA Palmitoyltransferase PFA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA4 PE=3 SV=2 145 266 2.0E-10
sp|Q91WU6|ZDHC7_MOUSE Palmitoyltransferase ZDHHC7 OS=Mus musculus GN=Zdhhc7 PE=1 SV=1 23 265 3.0E-10
sp|Q8BQQ1|ZDH14_MOUSE Probable palmitoyltransferase ZDHHC14 OS=Mus musculus GN=Zdhhc14 PE=1 SV=1 56 195 3.0E-10
sp|Q6BMV2|PFA3_DEBHA Palmitoyltransferase PFA3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFA3 PE=3 SV=2 19 360 3.0E-10
sp|Q923G5|ZDHC7_RAT Palmitoyltransferase ZDHHC7 OS=Rattus norvegicus GN=Zdhhc7 PE=1 SV=1 23 265 4.0E-10
sp|Q8IZN3|ZDH14_HUMAN Probable palmitoyltransferase ZDHHC14 OS=Homo sapiens GN=ZDHHC14 PE=1 SV=1 63 195 4.0E-10
sp|Q93VV0|ZDHC6_ARATH Probable protein S-acyltransferase 16 OS=Arabidopsis thaliana GN=PAT16 PE=2 SV=1 76 272 5.0E-10
sp|Q5FWL7|ZDH15_XENLA Palmitoyltransferase ZDHHC15 OS=Xenopus laevis GN=zdhhc15 PE=2 SV=1 135 252 5.0E-10
sp|Q5B3W7|ERFB_EMENI Palmitoyltransferase erf2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=erf2 PE=3 SV=2 56 232 7.0E-10
sp|Q5R5J8|ZDHC9_PONAB Palmitoyltransferase ZDHHC9 OS=Pongo abelii GN=ZDHHC9 PE=2 SV=1 53 195 8.0E-10
sp|Q7SFL7|ERFB_NEUCR Palmitoyltransferase erf2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-2 PE=3 SV=1 16 214 9.0E-10
sp|Q5AGV7|PFA4_CANAL Palmitoyltransferase PFA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PFA4 PE=3 SV=1 10 245 1.0E-09
sp|B3DN87|ZDH12_ARATH Probable protein S-acyltransferase 1 OS=Arabidopsis thaliana GN=PAT01 PE=2 SV=1 21 201 1.0E-09
sp|Q4IA62|PFA3_GIBZE Palmitoyltransferase PFA3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFA3 PE=3 SV=1 136 209 1.0E-09
sp|Q555N7|ZDHC4_DICDI Putative ZDHHC-type palmitoyltransferase 4 OS=Dictyostelium discoideum GN=DDB_G0274251 PE=3 SV=1 133 240 2.0E-09
sp|Q9NXF8|ZDHC7_HUMAN Palmitoyltransferase ZDHHC7 OS=Homo sapiens GN=ZDHHC7 PE=1 SV=2 147 265 2.0E-09
sp|Q86A83|ZDHC2_DICDI Putative ZDHHC-type palmitoyltransferase 2 OS=Dictyostelium discoideum GN=DDB_G0274739 PE=2 SV=2 139 197 3.0E-09
sp|Q06551|ERFB_YEAST Palmitoyltransferase ERF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERF2 PE=1 SV=1 42 220 4.0E-09
sp|Q0WQK2|ZDHC9_ARATH Probable protein S-acyltransferase 7 OS=Arabidopsis thaliana GN=PAT07 PE=1 SV=1 55 262 6.0E-09
sp|Q9NUE0|ZDH18_HUMAN Palmitoyltransferase ZDHHC18 OS=Homo sapiens GN=ZDHHC18 PE=2 SV=2 41 195 8.0E-09
sp|Q5Y5T2|ZDH18_MOUSE Palmitoyltransferase ZDHHC18 OS=Mus musculus GN=Zdhhc18 PE=1 SV=4 53 195 1.0E-08
sp|Q5W0Z9|ZDH20_HUMAN Probable palmitoyltransferase ZDHHC20 OS=Homo sapiens GN=ZDHHC20 PE=1 SV=1 23 187 1.0E-08
sp|Q6C7Q0|PFA4_YARLI Palmitoyltransferase PFA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PFA4 PE=3 SV=1 141 197 1.0E-08
sp|Q8VYP5|ZDH14_ARATH Probable protein S-acyltransferase 14 OS=Arabidopsis thaliana GN=PAT14 PE=2 SV=1 55 188 1.0E-08
sp|Q4PE27|PFA4_USTMA Palmitoyltransferase PFA4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PFA4 PE=3 SV=2 139 201 1.0E-08
sp|Q9D270|ZDH21_MOUSE Probable palmitoyltransferase ZDHHC21 OS=Mus musculus GN=Zdhhc21 PE=1 SV=2 147 258 1.0E-08
sp|A2VDT6|ZDH21_BOVIN Probable palmitoyltransferase ZDHHC21 OS=Bos taurus GN=ZDHHC21 PE=2 SV=1 147 258 2.0E-08
sp|Q2TGJ1|ZDH18_RAT Palmitoyltransferase ZDHHC18 OS=Rattus norvegicus GN=Zdhhc18 PE=2 SV=1 53 195 2.0E-08
sp|Q0VC89|ZDH20_BOVIN Probable palmitoyltransferase ZDHHC20 OS=Bos taurus GN=ZDHHC20 PE=2 SV=1 23 187 2.0E-08
sp|O14345|PFA3_SCHPO Palmitoyltransferase pfa3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfa3 PE=3 SV=1 122 262 2.0E-08
sp|Q9M306|ZDH10_ARATH Probable protein S-acyltransferase 5 OS=Arabidopsis thaliana GN=PAT05 PE=1 SV=2 132 201 2.0E-08
sp|Q9M1K5|ZDH13_ARATH Probable protein S-acyltransferase 4 OS=Arabidopsis thaliana GN=PAT04 PE=2 SV=1 59 201 3.0E-08
sp|Q5RB84|ZDH21_PONAB Probable palmitoyltransferase ZDHHC21 OS=Pongo abelii GN=ZDHHC21 PE=2 SV=1 147 258 3.0E-08
sp|Q8IVQ6|ZDH21_HUMAN Palmitoyltransferase ZDHHC21 OS=Homo sapiens GN=ZDHHC21 PE=2 SV=1 147 258 3.0E-08
sp|Q550R7|ZDHC1_DICDI Putative ZDHHC-type palmitoyltransferase 1 OS=Dictyostelium discoideum GN=DDB_G0276997 PE=3 SV=3 60 218 4.0E-08
sp|O80685|ZDHC4_ARATH Probable protein S-acyltransferase 2 OS=Arabidopsis thaliana GN=PAT02 PE=2 SV=3 77 201 5.0E-08
sp|Q5Y5T5|ZDHC8_MOUSE Probable palmitoyltransferase ZDHHC8 OS=Mus musculus GN=Zdhhc8 PE=1 SV=1 133 263 5.0E-08
sp|Q2THX0|ZDHC8_PANTR Probable palmitoyltransferase ZDHHC8 OS=Pan troglodytes GN=ZDHHC8 PE=2 SV=1 133 263 5.0E-08
sp|Q9ULC8|ZDHC8_HUMAN Probable palmitoyltransferase ZDHHC8 OS=Homo sapiens GN=ZDHHC8 PE=1 SV=3 133 263 5.0E-08
sp|Q2THW8|ZDHC8_CANLF Probable palmitoyltransferase ZDHHC8 OS=Canis lupus familiaris GN=ZDHHC8 PE=2 SV=1 133 263 6.0E-08
sp|Q8I0G4|ZDHC4_CAEEL Zinc finger DHHC domain-containing protein 4 OS=Caenorhabditis elegans GN=dhhc-4 PE=3 SV=1 12 201 8.0E-08
sp|Q4WWN2|ERFB_ASPFU Palmitoyltransferase erf2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=erf2 PE=3 SV=1 145 227 9.0E-08
sp|Q6CUB5|PFA4_KLULA Palmitoyltransferase PFA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PFA4 PE=3 SV=1 136 198 1.0E-07
sp|Q12006|PFA4_YEAST Palmitoyltransferase PFA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFA4 PE=1 SV=1 137 257 1.0E-07
sp|Q6FSS4|ERFB_CANGA Palmitoyltransferase ERF2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERF2 PE=3 SV=1 42 237 1.0E-07
sp|P0CS68|PFA4_CRYNJ Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PFA4 PE=3 SV=2 144 197 2.0E-07
sp|P0CS69|PFA4_CRYNB Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PFA4 PE=3 SV=1 144 197 2.0E-07
sp|Q6FVE6|PFA4_CANGA Palmitoyltransferase PFA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PFA4 PE=3 SV=1 146 257 3.0E-07
sp|J9VJ99|PFA4_CRYNH Palmitoyltransferase PFA4 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PFA4 PE=1 SV=2 144 197 3.0E-07
sp|Q4I2M7|ERFB_GIBZE Palmitoyltransferase ERF2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ERF2 PE=3 SV=1 145 245 6.0E-07
sp|Q2THX1|ZDHC5_PANTR Palmitoyltransferase ZDHHC5 OS=Pan troglodytes GN=ZDHHC5 PE=2 SV=1 133 195 7.0E-07
sp|Q76IC6|ZDH23_RAT Palmitoyltransferase ZDHHC23 OS=Rattus norvegicus GN=Zdhhc23 PE=1 SV=2 56 191 7.0E-07
sp|Q8VDZ4|ZDHC5_MOUSE Palmitoyltransferase ZDHHC5 OS=Mus musculus GN=Zdhhc5 PE=1 SV=1 133 195 7.0E-07
sp|Q9C0B5|ZDHC5_HUMAN Palmitoyltransferase ZDHHC5 OS=Homo sapiens GN=ZDHHC5 PE=1 SV=2 133 195 8.0E-07
sp|Q2THW7|ZDHC5_RAT Palmitoyltransferase ZDHHC5 OS=Rattus norvegicus GN=Zdhhc5 PE=1 SV=1 133 195 8.0E-07
sp|Q2THW9|ZDHC5_CANLF Palmitoyltransferase ZDHHC5 OS=Canis lupus familiaris GN=ZDHHC5 PE=2 SV=1 133 195 8.0E-07
sp|Q5R838|ZDHC5_PONAB Palmitoyltransferase ZDHHC5 OS=Pongo abelii GN=ZDHHC5 PE=2 SV=1 133 195 8.0E-07
sp|E1BLT8|ZDHC5_BOVIN Palmitoyltransferase ZDHHC5 OS=Bos taurus GN=ZDHHC5 PE=3 SV=1 133 195 8.0E-07
sp|Q6C890|ERFB_YARLI Palmitoyltransferase ERF2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERF2 PE=3 SV=2 56 205 1.0E-06
sp|Q94C49|ZDH18_ARATH Probable protein S-acyltransferase 13 OS=Arabidopsis thaliana GN=PAT13 PE=2 SV=1 115 187 1.0E-06
sp|Q75CB4|PFA4_ASHGO Palmitoyltransferase PFA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PFA4 PE=3 SV=2 145 360 2.0E-06
sp|Q58CU4|ZDH16_BOVIN Probable palmitoyltransferase ZDHHC16 OS=Bos taurus GN=ZDHHC16 PE=2 SV=1 147 202 2.0E-06
sp|Q9ESG8|ZDH16_MOUSE Probable palmitoyltransferase ZDHHC16 OS=Mus musculus GN=Zdhhc16 PE=1 SV=2 147 202 3.0E-06
sp|Q969W1|ZDH16_HUMAN Probable palmitoyltransferase ZDHHC16 OS=Homo sapiens GN=ZDHHC16 PE=2 SV=1 147 202 3.0E-06
sp|Q4R7E2|ZDH16_MACFA Probable palmitoyltransferase ZDHHC16 OS=Macaca fascicularis GN=ZDHHC16 PE=2 SV=1 147 202 3.0E-06
sp|Q500Z2|ZDH20_ARATH Probable protein S-acyltransferase 15 OS=Arabidopsis thaliana GN=PAT15 PE=2 SV=1 147 196 4.0E-06
sp|Q8VYS8|ZDH24_ARATH Probable protein S-acyltransferase 9 OS=Arabidopsis thaliana GN=PAT09 PE=2 SV=1 39 262 5.0E-06
sp|Q5Y5T3|ZDH23_MOUSE Palmitoyltransferase ZDHHC23 OS=Mus musculus GN=Zdhhc23 PE=2 SV=1 140 272 6.0E-06
sp|Q5M757|ZDH15_ARATH Probable protein S-acyltransferase 12 OS=Arabidopsis thaliana GN=PAT12 PE=2 SV=1 55 188 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 50 72 22
3 190 212 22
4 224 246 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2642
MMRSSGSDGAAATRWSMRLVPCIVFASFVVPSYAFIHRVCVHDLYHTRRKTGLFVAMLVLYVLFIFLTMAAYLRT
ALAIQRDPGLVPLIHDLDPGGKTQTDRKAARGRDLEANPWVPPDQNPDSPGLEAFYSKDVFVCEADGRPKWCSEC
RQWKPDRAHHSRELGRCVRKMDHLCPWVGGMVSETSFNFFFQFTLYTVCLCAVGVGASAYCLQQQSSRGPSVDGW
VISVVAVTSFYAFFASAMVLTSLRFIFTNITNIDVLKKSQVVYLAVRIPRHSPPSTRFSTIVYPLPRPAPWPTSQ
RAPAPPTGADLDPASARDQRATRKFAILRADNRENPWDLGFWANWKSVMGNHVVDWLLPLRHSPCCNHESMRSDY
ELGPLLTKLKRQYDVPDLDGDVGGTVEMHDAIRRTT*
Coding >Hirsu2|2642
ATGATGCGCTCGAGCGGCAGCGACGGAGCTGCTGCCACTCGCTGGTCGATGCGCCTCGTCCCCTGCATCGTCTTC
GCCTCCTTCGTCGTCCCCAGCTACGCCTTCATCCACCGCGTCTGCGTCCATGATCTGTATCACACCAGGCGCAAG
ACGGGCCTCTTCGTCGCCATGCTGGTCCTCTACGTCCTCTTCATCTTCCTCACCATGGCCGCCTATCTCCGAACC
GCCCTCGCCATCCAACGCGACCCCGGCCTCGTGCCGCTCATACACGACCTCGACCCGGGCGGCAAGACGCAGACG
GACCGCAAGGCGGCCCGCGGCAGGGACCTCGAGGCGAACCCGTGGGTGCCCCCGGATCAGAACCCCGACAGCCCG
GGCCTCGAGGCCTTCTACAGCAAGGACGTCTTCGTCTGCGAGGCGGACGGCCGGCCCAAATGGTGCTCCGAATGT
CGCCAGTGGAAGCCCGACCGGGCCCATCACTCGCGCGAGCTGGGCCGTTGCGTGCGCAAGATGGACCATCTCTGC
CCCTGGGTTGGCGGCATGGTTTCCGAGACGTCCTTCAACTTCTTCTTCCAGTTCACCCTCTACACCGTCTGTCTG
TGCGCTGTAGGTGTCGGGGCCAGCGCGTACTGCCTGCAGCAGCAGAGTTCGAGGGGACCCTCCGTCGACGGCTGG
GTCATTTCCGTCGTCGCCGTCACCTCCTTCTACGCCTTCTTCGCCTCCGCCATGGTTCTGACCTCGCTTCGGTTC
ATCTTCACCAACATCACCAACATCGACGTCCTTAAGAAGTCTCAAGTCGTCTACCTCGCCGTTCGCATTCCGCGT
CACAGTCCGCCCTCTACTCGCTTTTCCACCATCGTCTATCCCCTGCCACGGCCTGCTCCGTGGCCGACCTCGCAA
AGAGCACCCGCTCCCCCGACCGGTGCCGATCTTGATCCGGCGTCGGCAAGGGACCAGCGCGCAACGAGAAAGTTC
GCAATCCTGCGAGCTGATAATCGCGAGAATCCCTGGGACTTGGGCTTTTGGGCCAACTGGAAATCCGTCATGGGC
AACCACGTCGTAGACTGGTTGCTCCCTCTCCGTCATTCTCCCTGCTGCAACCACGAGAGCATGCGCAGCGATTAC
GAGCTTGGCCCACTCCTGACGAAGCTCAAGAGGCAATACGACGTACCGGACCTCGACGGCGACGTCGGCGGAACC
GTCGAGATGCACGACGCGATTAGGCGCACAACTTAA
Transcript >Hirsu2|2642
ATGATGCGCTCGAGCGGCAGCGACGGAGCTGCTGCCACTCGCTGGTCGATGCGCCTCGTCCCCTGCATCGTCTTC
GCCTCCTTCGTCGTCCCCAGCTACGCCTTCATCCACCGCGTCTGCGTCCATGATCTGTATCACACCAGGCGCAAG
ACGGGCCTCTTCGTCGCCATGCTGGTCCTCTACGTCCTCTTCATCTTCCTCACCATGGCCGCCTATCTCCGAACC
GCCCTCGCCATCCAACGCGACCCCGGCCTCGTGCCGCTCATACACGACCTCGACCCGGGCGGCAAGACGCAGACG
GACCGCAAGGCGGCCCGCGGCAGGGACCTCGAGGCGAACCCGTGGGTGCCCCCGGATCAGAACCCCGACAGCCCG
GGCCTCGAGGCCTTCTACAGCAAGGACGTCTTCGTCTGCGAGGCGGACGGCCGGCCCAAATGGTGCTCCGAATGT
CGCCAGTGGAAGCCCGACCGGGCCCATCACTCGCGCGAGCTGGGCCGTTGCGTGCGCAAGATGGACCATCTCTGC
CCCTGGGTTGGCGGCATGGTTTCCGAGACGTCCTTCAACTTCTTCTTCCAGTTCACCCTCTACACCGTCTGTCTG
TGCGCTGTAGGTGTCGGGGCCAGCGCGTACTGCCTGCAGCAGCAGAGTTCGAGGGGACCCTCCGTCGACGGCTGG
GTCATTTCCGTCGTCGCCGTCACCTCCTTCTACGCCTTCTTCGCCTCCGCCATGGTTCTGACCTCGCTTCGGTTC
ATCTTCACCAACATCACCAACATCGACGTCCTTAAGAAGTCTCAAGTCGTCTACCTCGCCGTTCGCATTCCGCGT
CACAGTCCGCCCTCTACTCGCTTTTCCACCATCGTCTATCCCCTGCCACGGCCTGCTCCGTGGCCGACCTCGCAA
AGAGCACCCGCTCCCCCGACCGGTGCCGATCTTGATCCGGCGTCGGCAAGGGACCAGCGCGCAACGAGAAAGTTC
GCAATCCTGCGAGCTGATAATCGCGAGAATCCCTGGGACTTGGGCTTTTGGGCCAACTGGAAATCCGTCATGGGC
AACCACGTCGTAGACTGGTTGCTCCCTCTCCGTCATTCTCCCTGCTGCAACCACGAGAGCATGCGCAGCGATTAC
GAGCTTGGCCCACTCCTGACGAAGCTCAAGAGGCAATACGACGTACCGGACCTCGACGGCGACGTCGGCGGAACC
GTCGAGATGCACGACGCGATTAGGCGCACAACTTAA
Gene >Hirsu2|2642
ATGATGCGCTCGAGCGGCAGCGACGGAGCTGCTGCCACTCGCTGGTCGATGCGCCTCGTCCCCTGCATCGTCTTC
GCCTCCTTCGTCGTCCCCAGCTACGCCTTCATCCACCGCGTCTGCGGCAAGTCCGTCTGCTCGTTGCCGTTGCTT
CTCGCGCTGACCCCCCTTGCAGTCCATGATCTGTATCACACCAGGCGCAAGACGGGCCTCTTCGTCGCCATGCTG
GTCCTCTACGTCCTCTTCATCTTCCTCACCATGGCCGCCTATCTCCGAACCGCCCTCGCCATCCAACGCGACCCC
GGCCTCGTGCCGCTCATACACGACCTCGACCCGGGCGGCAAGACGCAGACGGACCGCAAGGCGGCCCGCGGCAGG
GACCTCGAGGCGAACCCGTGGGTGCCCCCGGATCAGAACCCCGACAGCCCGGGCCTCGAGGCCTTCTACAGCAAG
GACGTCTTCGTCTGCGAGGCGGACGGCCGGCCCAAATGGTGCTCCGAATGTCGCCAGTGGAAGCCCGACCGGGCC
CATCACTCGCGCGAGCTGGGCCGTTGCGTGCGCAAGATGGACCATCTCTGCCCCTGGGTTGGCGGCATGGTTTCC
GAGACGTGTAAGTCTGCCGGCTCCGGCCCTGCCGCTCCCGCACCGCTGACACCCATCTAGCCTTCAACTTCTTCT
TCCAGTTCACCCTCTACACCGTCTGTCTGTGCGCTGTAGGTGTCGGGGCCAGCGCGTACTGCCTGCAGCAGCAGA
GTTCGAGGGGACCCTCCGTCGACGGCTGGGTCATTTCCGTCGTCGCCGTCACCTCCTTCTACGCCTTCTTCGCCT
CCGCCATGGTTCTGACCTCGCTTCGGTTCATCTTCACCAACATCACCAACATCGACGTCCTTAAGAAGTCTCAAG
TCGTCTACCTCGCCGTTCGCATTCCGCGTCACAGTCCGCCCTCTACTCGCTTTTCCACCATCGTCTATCCCCTGC
CACGGCCTGCTCCGTGGCCGACCTCGCAAAGAGCACCCGCTCCCCCGACCGGTGCCGATCTTGATCCGGCGTCGG
CAAGGGACCAGCGCGCAACGAGAAAGTTCGCAATCCTGCGAGCTGATAATCGCGAGAATCCCTGGGACTTGGGCT
TTTGGGCCAACTGGAAATCCGTCATGGGCAACCACGTCGTAGACTGGTTGCTCCCTCTCCGTCATTCTCCCTGCT
GCAACCACGAGAGCATGCGCAGCGATTACGAGCTTGGCCCACTCCTGACGAAGCTCAAGAGGCAATACGACGTAC
CGGACCTCGACGGCGACGTCGGCGGAACCGTCGAGATGCACGACGCGATTAGGCGCACAACTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail