Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|264
Gene name
LocationContig_105:3612..5328
Strand+
Gene length (bp)1716
Transcript length (bp)1413
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.6E-20 57 422
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-10 284 465

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q08280|BSC6_YEAST Bypass of stop codon protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BSC6 PE=1 SV=1 51 457 1.0E-24

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

Domain # Start End Length
1 56 78 22
2 83 105 22
3 174 196 22
4 206 228 22
5 282 304 22
6 348 367 19
7 369 391 22
8 406 428 22
9 433 455 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|264
MTATTTLQPAVEALELDRPTAPEHESAPATGSEPSPPDTGLSRAEAKTRHLQLASVGFSFLVAGVNDGSIGALLP
YVLREYRISTAIVSSIYGASFVGWLTAALTSTHLCQHLDLGAVLAVGALCQVAAHALRAWGPPLGLFTASFALAS
LGQAFQDTQGNTLVAASKGAAHRWLALIHASYMAGCLVGPFVATAVAASGGRVSRWYLFYAFPLGLGVANLVAVF
VAFRGSIRLRRQTAPAVSQSRSLQDGSGSSYAQGREATAGDRSAASLIQATLAMPSVWLLCTFFFFYLGSVLTAS
GWVVEYLVDVRHGNLSQMGYVPAGFNGGALLGRLLLAEPTHRFGERNMVLFYTLSAIALQLVFWLVPNIIAASIA
VSLIGFFTGPLFATGISLGSKLFPPHLHSTALAFVFVFAQMGGSLFPIVTGLVSARASVTVLQPILTGLLSATAI
SWILVPRPKSSPNSGALHQE*
Coding >Hirsu2|264
ATGACGGCCACGACCACGCTTCAACCTGCTGTCGAAGCGCTCGAGCTCGATCGGCCGACGGCCCCGGAGCACGAG
TCCGCGCCGGCGACCGGCTCGGAGCCGTCCCCACCCGACACAGGTCTGAGCCGGGCCGAGGCAAAGACCCGTCAT
CTGCAGCTGGCCAGCGTCGGCTTCTCCTTCTTGGTGGCAGGCGTCAACGACGGCAGCATCGGCGCGCTGCTCCCT
TACGTCCTCCGCGAGTACCGCATCAGCACCGCCATCGTCTCCAGCATTTATGGCGCCAGCTTCGTCGGCTGGCTG
ACGGCGGCGTTGACGAGCACGCACCTGTGCCAGCACCTCGATCTCGGCGCCGTGCTGGCCGTCGGCGCGCTCTGC
CAGGTCGCCGCGCACGCCCTCCGCGCCTGGGGCCCGCCCCTCGGCCTCTTCACCGCCTCGTTCGCGCTCGCCAGC
CTCGGCCAGGCCTTTCAGGACACCCAGGGGAACACCTTGGTGGCGGCCTCCAAGGGCGCGGCTCATCGCTGGCTG
GCCCTCATCCACGCCTCCTACATGGCCGGCTGCCTTGTCGGGCCCTTTGTCGCCACGGCCGTTGCCGCCTCTGGC
GGCCGTGTCTCTCGCTGGTATCTATTCTACGCTTTCCCCCTGGGCCTGGGTGTCGCAAACTTGGTCGCCGTCTTC
GTCGCATTTCGGGGCTCAATCCGGCTGCGGCGCCAGACCGCTCCGGCAGTATCTCAAAGCCGCTCTCTTCAAGAT
GGCTCCGGCAGCTCTTACGCACAAGGTAGAGAGGCTACTGCTGGTGACAGAAGTGCCGCCAGCCTCATCCAGGCT
ACCCTGGCCATGCCTTCGGTCTGGCTGCTGTGCACCTTTTTCTTCTTCTATCTCGGCTCCGTCTTGACGGCGAGC
GGCTGGGTCGTCGAGTATCTCGTCGATGTCCGCCACGGCAACTTATCGCAAATGGGCTATGTGCCGGCCGGCTTC
AATGGCGGAGCGCTCCTCGGCAGGCTGCTCCTGGCTGAGCCGACACACCGATTCGGCGAGCGCAACATGGTGCTC
TTCTACACGCTTTCTGCCATCGCCCTCCAGCTTGTTTTTTGGCTGGTACCAAACATCATCGCGGCCTCGATTGCC
GTCAGTCTCATTGGTTTCTTTACCGGCCCGCTATTCGCTACCGGCATATCTCTCGGCTCCAAGCTTTTCCCGCCG
CATCTCCACTCGACCGCCCTGGCCTTCGTCTTTGTCTTCGCTCAGATGGGCGGCTCTTTGTTTCCCATCGTCACG
GGTCTGGTCTCGGCGCGTGCCAGTGTCACCGTCCTACAACCCATTCTGACAGGGCTTCTCTCAGCAACGGCAATC
AGCTGGATTCTCGTGCCGCGCCCCAAATCGTCGCCGAACTCTGGCGCATTACACCAAGAATAG
Transcript >Hirsu2|264
ATGACGGCCACGACCACGCTTCAACCTGCTGTCGAAGCGCTCGAGCTCGATCGGCCGACGGCCCCGGAGCACGAG
TCCGCGCCGGCGACCGGCTCGGAGCCGTCCCCACCCGACACAGGTCTGAGCCGGGCCGAGGCAAAGACCCGTCAT
CTGCAGCTGGCCAGCGTCGGCTTCTCCTTCTTGGTGGCAGGCGTCAACGACGGCAGCATCGGCGCGCTGCTCCCT
TACGTCCTCCGCGAGTACCGCATCAGCACCGCCATCGTCTCCAGCATTTATGGCGCCAGCTTCGTCGGCTGGCTG
ACGGCGGCGTTGACGAGCACGCACCTGTGCCAGCACCTCGATCTCGGCGCCGTGCTGGCCGTCGGCGCGCTCTGC
CAGGTCGCCGCGCACGCCCTCCGCGCCTGGGGCCCGCCCCTCGGCCTCTTCACCGCCTCGTTCGCGCTCGCCAGC
CTCGGCCAGGCCTTTCAGGACACCCAGGGGAACACCTTGGTGGCGGCCTCCAAGGGCGCGGCTCATCGCTGGCTG
GCCCTCATCCACGCCTCCTACATGGCCGGCTGCCTTGTCGGGCCCTTTGTCGCCACGGCCGTTGCCGCCTCTGGC
GGCCGTGTCTCTCGCTGGTATCTATTCTACGCTTTCCCCCTGGGCCTGGGTGTCGCAAACTTGGTCGCCGTCTTC
GTCGCATTTCGGGGCTCAATCCGGCTGCGGCGCCAGACCGCTCCGGCAGTATCTCAAAGCCGCTCTCTTCAAGAT
GGCTCCGGCAGCTCTTACGCACAAGGTAGAGAGGCTACTGCTGGTGACAGAAGTGCCGCCAGCCTCATCCAGGCT
ACCCTGGCCATGCCTTCGGTCTGGCTGCTGTGCACCTTTTTCTTCTTCTATCTCGGCTCCGTCTTGACGGCGAGC
GGCTGGGTCGTCGAGTATCTCGTCGATGTCCGCCACGGCAACTTATCGCAAATGGGCTATGTGCCGGCCGGCTTC
AATGGCGGAGCGCTCCTCGGCAGGCTGCTCCTGGCTGAGCCGACACACCGATTCGGCGAGCGCAACATGGTGCTC
TTCTACACGCTTTCTGCCATCGCCCTCCAGCTTGTTTTTTGGCTGGTACCAAACATCATCGCGGCCTCGATTGCC
GTCAGTCTCATTGGTTTCTTTACCGGCCCGCTATTCGCTACCGGCATATCTCTCGGCTCCAAGCTTTTCCCGCCG
CATCTCCACTCGACCGCCCTGGCCTTCGTCTTTGTCTTCGCTCAGATGGGCGGCTCTTTGTTTCCCATCGTCACG
GGTCTGGTCTCGGCGCGTGCCAGTGTCACCGTCCTACAACCCATTCTGACAGGGCTTCTCTCAGCAACGGCAATC
AGCTGGATTCTCGTGCCGCGCCCCAAATCGTCGCCGAACTCTGGCGCATTACACCAAGAATAG
Gene >Hirsu2|264
ATGACGGCCACGACCACGCTTCAACCTGCTGTCGAAGCGCTCGAGCTCGATCGGCCGACGGCCCCGGAGCACGAG
TCCGCGCCGGCGACCGGCTCGGAGCCGTCCCCACCCGACACAGGTCTGAGCCGGGCCGAGGCAAAGACCCGTCAT
CTGCAGCTGGCCAGCGTCGGCTTCTCCTTCTTGGTGGCAGGCGTCAACGACGGCAGCATCGGCGCGCTGCTCCCT
TACGTCCTCCGCGAGTACCGCATCAGCACCGCCATCGTCTCCAGCATGTGAGCCTCCTCGAGATCCGAGCTTCAC
GTGATCTGCCGCGGCATGATCGTGTGCCGGGAGGCGACTGGGGTTTGACGGATTCTGACACCCGGACCTGGCCGG
CAGTTATGGCGCCAGCTTCGTCGGCTGGCTGACGGCGGCGTTGACGAGCACGCACCTGTGCCAGCACCTCGATCT
CGGCGCCGTGCTGGCCGTCGGCGCGCTCTGCCAGGTCGCCGCGCACGCCCTCCGCGCCTGGGGCCCGCCCCTCGG
CCTCTTCACCGCCTCGTTCGCGCTCGCCAGCCTCGGCCAGGCCTTTCAGGACACCCAGGGGAACACCTTGGTGGC
GGCCTCCAAGGGCGCGGCTCATCGCTGGCTGGCCCTCATCCACGCCTCCTACATGGCCGGCTGCCTTGTCGGGCC
CTTTGTCGCCACGGCCGTTGCCGCCTCTGGCGGCCGTGTCTCTCGCTGGTATCTATTCTACGCTTTCCCCCTGGG
CCTGGGTGTCGCAAACTTGGTCGCCGTCTTCGTCGCATTTCGGGGCTCAATCCGGCTGCGGCGCCAGACCGCTCC
GGCAGTATCTCAAAGCCGCTCTCTTCAAGATGGCTCCGGCAGCTCTTACGCACAAGGTAGAGAGGCTACTGCTGG
TGACAGAAGTGCCGCCAGCCTCATCCAGGCTACCCTGGCCATGCCTTCGGTCTGGCTGCTGTGCACCTTTTTCTT
CTTCTATCTCGGCTCCGTCTTGACGGCGAGCGGCTGGGTCGTCGAGTATCTCGTCGATGTCCGCCACGGCAACTT
ATCGCAAATGGGCTATGTGCCGGCCGGCTTCAATGGCGGAGCGCTCCTCGGCAGGCTGCTCCTGGCTGAGCCGAC
ACACCGATTCGGCGAGCGCAACATGGTGCTCTTCTACACGCTTTCTGCCATCGCCCTCCAGCTTGTTTTTTGGCT
GTAAGTCCCGGACCTAGTCAGCCTTGTCAAGGCCGCCCTTCACCCACGTCGAGCCGCAACAGGATGATCGGCCAC
GGGAGCGGATTTCGCTGCTAAACAGTCTGTCTAAACAATAGGGTACCAAACATCATCGCGGCCTCGATTGCCGTC
AGTCTCATTGGTTTCTTTACCGGCCCGCTATTCGCTACCGTGAGTCGGTCCGACTTGTCCGCTTCTAGGCTCTCT
ATATGCCTCTATTCGCATCCCGTCAACTGATCCGGCGTCATATAGGGCATATCTCTCGGCTCCAAGCTTTTCCCG
CCGCATCTCCACTCGACCGCCCTGGCCTTCGTCTTTGTCTTCGCTCAGATGGGCGGCTCTTTGTTTCCCATCGTC
ACGGGTCTGGTCTCGGCGCGTGCCAGTGTCACCGTCCTACAACCCATTCTGACAGGGCTTCTCTCAGCAACGGCA
ATCAGCTGGATTCTCGTGCCGCGCCCCAAATCGTCGCCGAACTCTGGCGCATTACACCAAGAATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail