Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2622
Gene name
LocationContig_1631:929..3818
Strand+
Gene length (bp)2889
Transcript length (bp)2889
Coding sequence length (bp)2889
Protein length (aa) 963

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 1.4E-73 597 959
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 3.2E-26 181 445

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0015631 tubulin binding No
GO:0005515 protein binding No
GO:0003674 molecular_function No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2622
MTRADDEPYVFAIPQFGQTSKWLERVAQEAPPFFATNPGPFAVSAPGEPSSVASDEPIPGLLNFKPIAPDKDGFF
KLPPLGLAESAPGTAEPAPRPAADDSSEAEATGSDAWIGTEEPPTKPVGFRTWDSFRTGGLAPHRPLLISEAGPT
AYDALLRRTTGPPGLSNSDVSVVETRAYFSSLLALALGRDSVFFRKADHPQTFKPTLAKIRISGYSRQLLQGVES
QTLRCGMSFSQLSAFVRTTYATKSTRCEVALASSIDQILQAVERKLTVTGTRPRSLLQLQSSIRAVSAMLLPLRK
LVLRLRRGALDEDVLSLLFHTASALDDGEGCIRFAFRQILRRVSAPWIEHLEEWIGTRQEEGIPLSKTHIGEGRG
FVKVEAESYVDDLGRQVEEVDFRLDRSRVPDFMPDDLIDSIFETGRNLRFIKSFHPEHPLAQQCVVESSQPPKAQ
WLYDWDSILELEGRVSRYRDSLCDALEESRRSSSPRACRVGVPAPEPEPTSPLGFFGLDEKDMEACMLASMAQLS
RPMTEQESKDPEDDVLRRRLFDSHGPDSEDAGATPHWSLLPVLSFGGIASAQGQIVSRESLRLLFDAHDIGKHLR
LQRDFHLLGNGMFSSRLAQALFDPDLHSAERVAGTVRQGGVMGLRLGGRDSWPPASSELRLVLMGVLSDSYGSQQ
ESGRTERPARDGDGVALPGDLSFAVRDLSTEEIDKCMNPDSLEALDFLRLSYTTPPELCGIITPINMTHYDRIFK
LLLRVLRMLHVVNQHCLGINSRAGTWQSPSSASYLFAREAHRFVSSVASYFFDSGIAVPWQTFEQGLAEMRAALG
DGRGGGPPEELPGPDKLRELHSRVLDRIMYALFLKKRQRPVLQLLEDLFGTVLEYAKFARGQASGTGGERAEGHD
RASELYGDFKRKMHVFMAVCRGLTEKGRAGSGRAVEELGVGEDSMVAQLLVKLDMGSFYTKR*
Coding >Hirsu2|2622
ATGACCAGGGCCGACGACGAACCGTACGTCTTCGCCATCCCCCAGTTCGGGCAAACGTCGAAATGGCTGGAGCGG
GTGGCCCAAGAGGCGCCGCCCTTCTTCGCCACCAACCCCGGCCCGTTCGCCGTCTCTGCGCCGGGAGAGCCGAGC
TCGGTCGCGTCGGATGAGCCGATCCCGGGCCTGTTGAACTTCAAGCCGATTGCGCCGGACAAGGATGGCTTCTTC
AAGCTCCCTCCGCTCGGCCTCGCCGAGTCCGCGCCCGGGACCGCTGAGCCGGCGCCCCGTCCCGCGGCCGACGAC
TCGAGTGAGGCCGAGGCCACGGGCAGCGACGCGTGGATCGGCACAGAGGAGCCGCCCACGAAGCCGGTGGGCTTC
AGGACATGGGACTCCTTCCGCACCGGAGGTCTCGCGCCGCATCGGCCCCTGCTCATCAGCGAGGCTGGCCCGACC
GCCTACGACGCCTTGCTCCGCCGCACCACGGGTCCGCCAGGGCTCAGCAATTCGGACGTTTCCGTCGTCGAGACC
CGAGCCTACTTCTCTTCCCTGCTGGCCCTGGCCCTCGGCCGAGACTCAGTCTTCTTCCGCAAGGCGGACCACCCC
CAAACCTTCAAGCCCACTCTTGCCAAGATCCGGATCTCGGGCTACTCTCGTCAACTGCTGCAAGGCGTGGAAAGC
CAGACACTTCGCTGTGGCATGTCTTTCTCGCAGCTCAGCGCCTTCGTTCGCACCACCTATGCGACCAAGTCGACT
CGATGTGAGGTGGCTCTTGCCAGCAGCATCGACCAGATCTTGCAGGCCGTGGAGCGCAAGTTGACGGTCACCGGC
ACGAGGCCCCGCTCACTCTTGCAACTCCAATCATCCATCAGGGCCGTCTCGGCAATGCTGCTGCCGCTGAGGAAA
CTCGTTCTGCGTCTGCGGCGGGGAGCCTTGGACGAAGACGTCCTGTCACTACTCTTCCACACGGCATCCGCCCTG
GACGACGGCGAAGGCTGTATCCGATTCGCGTTTCGCCAGATTCTGCGTCGCGTGTCTGCCCCCTGGATCGAGCAT
CTTGAAGAATGGATCGGGACGAGACAAGAAGAGGGCATTCCGCTGTCAAAAACCCACATAGGGGAGGGCAGGGGA
TTTGTCAAGGTAGAGGCAGAGTCGTACGTCGACGACCTCGGTCGGCAAGTGGAGGAAGTCGACTTCCGACTGGAT
CGCAGCAGGGTTCCAGACTTCATGCCGGATGATCTGATCGACTCCATCTTCGAGACAGGTCGGAATCTGCGCTTC
ATCAAGTCCTTCCACCCAGAGCACCCTCTGGCTCAACAATGCGTGGTCGAGTCGTCGCAACCACCCAAGGCACAA
TGGCTTTACGACTGGGACTCAATATTGGAGCTCGAGGGTCGAGTTTCTCGCTACCGTGACAGTCTCTGCGACGCC
CTGGAGGAGAGTCGCCGCAGCTCGTCGCCCCGGGCGTGCAGAGTCGGGGTTCCTGCACCCGAACCCGAGCCGACC
TCTCCACTCGGCTTTTTCGGGCTCGACGAGAAGGACATGGAGGCGTGTATGCTGGCGTCGATGGCACAACTGAGT
CGGCCGATGACTGAGCAGGAATCGAAGGATCCGGAGGACGACGTGCTCCGTCGGCGGCTCTTCGACAGCCACGGC
CCGGATTCGGAAGATGCGGGTGCGACGCCGCACTGGTCGCTCTTACCGGTGCTGTCGTTTGGCGGCATCGCGTCG
GCGCAAGGCCAGATTGTCAGTCGTGAGAGTCTCCGGCTTCTGTTCGACGCGCACGACATTGGCAAGCACCTGAGG
CTGCAAAGAGACTTTCACCTGCTCGGCAACGGCATGTTTAGCAGCCGGCTCGCGCAGGCGCTCTTCGATCCGGAC
CTGCATTCGGCAGAGAGGGTGGCCGGCACGGTCCGACAGGGGGGCGTCATGGGGCTGCGTCTGGGAGGACGGGAC
AGTTGGCCCCCGGCCAGCTCGGAGCTGCGCCTGGTCCTGATGGGAGTGCTGAGCGACAGTTACGGCTCGCAGCAG
GAGTCGGGCCGGACGGAGCGACCTGCTCGGGATGGCGATGGCGTGGCCCTGCCCGGCGACCTGAGCTTCGCGGTG
CGCGACCTGTCGACCGAGGAGATCGACAAGTGCATGAACCCGGATTCGCTGGAGGCGCTGGACTTTCTCCGTCTG
TCCTACACGACGCCGCCGGAGCTGTGCGGCATCATCACGCCGATCAACATGACGCACTACGACCGCATCTTCAAG
CTGCTGTTGCGAGTCTTGCGGATGCTGCACGTCGTCAACCAGCACTGCCTCGGCATCAACTCACGGGCCGGCACG
TGGCAAAGCCCGTCCAGCGCGTCGTACCTTTTTGCCCGAGAGGCACACCGTTTCGTGTCGAGCGTGGCCTCGTAC
TTTTTCGACTCGGGCATAGCCGTCCCGTGGCAGACGTTTGAGCAGGGGCTGGCCGAGATGCGGGCCGCGCTCGGG
GACGGCCGAGGGGGGGGGCCGCCGGAGGAGCTCCCGGGCCCCGACAAGCTGCGCGAGCTGCATAGCCGGGTCCTC
GACCGGATCATGTATGCCCTGTTCCTGAAGAAGAGGCAGCGGCCGGTGCTGCAGCTGCTCGAGGATTTGTTCGGC
ACGGTGCTCGAGTATGCCAAATTCGCACGAGGACAGGCCTCGGGCACGGGCGGCGAGAGGGCAGAGGGCCACGAC
AGGGCGTCGGAGCTGTACGGCGACTTCAAGAGGAAGATGCACGTCTTCATGGCGGTCTGTCGCGGCCTGACGGAG
AAGGGCCGGGCGGGCAGCGGGAGGGCCGTCGAGGAGCTGGGCGTCGGCGAGGACAGCATGGTGGCGCAGCTGCTG
GTGAAGCTGGACATGGGCAGCTTCTATACCAAGCGTTGA
Transcript >Hirsu2|2622
ATGACCAGGGCCGACGACGAACCGTACGTCTTCGCCATCCCCCAGTTCGGGCAAACGTCGAAATGGCTGGAGCGG
GTGGCCCAAGAGGCGCCGCCCTTCTTCGCCACCAACCCCGGCCCGTTCGCCGTCTCTGCGCCGGGAGAGCCGAGC
TCGGTCGCGTCGGATGAGCCGATCCCGGGCCTGTTGAACTTCAAGCCGATTGCGCCGGACAAGGATGGCTTCTTC
AAGCTCCCTCCGCTCGGCCTCGCCGAGTCCGCGCCCGGGACCGCTGAGCCGGCGCCCCGTCCCGCGGCCGACGAC
TCGAGTGAGGCCGAGGCCACGGGCAGCGACGCGTGGATCGGCACAGAGGAGCCGCCCACGAAGCCGGTGGGCTTC
AGGACATGGGACTCCTTCCGCACCGGAGGTCTCGCGCCGCATCGGCCCCTGCTCATCAGCGAGGCTGGCCCGACC
GCCTACGACGCCTTGCTCCGCCGCACCACGGGTCCGCCAGGGCTCAGCAATTCGGACGTTTCCGTCGTCGAGACC
CGAGCCTACTTCTCTTCCCTGCTGGCCCTGGCCCTCGGCCGAGACTCAGTCTTCTTCCGCAAGGCGGACCACCCC
CAAACCTTCAAGCCCACTCTTGCCAAGATCCGGATCTCGGGCTACTCTCGTCAACTGCTGCAAGGCGTGGAAAGC
CAGACACTTCGCTGTGGCATGTCTTTCTCGCAGCTCAGCGCCTTCGTTCGCACCACCTATGCGACCAAGTCGACT
CGATGTGAGGTGGCTCTTGCCAGCAGCATCGACCAGATCTTGCAGGCCGTGGAGCGCAAGTTGACGGTCACCGGC
ACGAGGCCCCGCTCACTCTTGCAACTCCAATCATCCATCAGGGCCGTCTCGGCAATGCTGCTGCCGCTGAGGAAA
CTCGTTCTGCGTCTGCGGCGGGGAGCCTTGGACGAAGACGTCCTGTCACTACTCTTCCACACGGCATCCGCCCTG
GACGACGGCGAAGGCTGTATCCGATTCGCGTTTCGCCAGATTCTGCGTCGCGTGTCTGCCCCCTGGATCGAGCAT
CTTGAAGAATGGATCGGGACGAGACAAGAAGAGGGCATTCCGCTGTCAAAAACCCACATAGGGGAGGGCAGGGGA
TTTGTCAAGGTAGAGGCAGAGTCGTACGTCGACGACCTCGGTCGGCAAGTGGAGGAAGTCGACTTCCGACTGGAT
CGCAGCAGGGTTCCAGACTTCATGCCGGATGATCTGATCGACTCCATCTTCGAGACAGGTCGGAATCTGCGCTTC
ATCAAGTCCTTCCACCCAGAGCACCCTCTGGCTCAACAATGCGTGGTCGAGTCGTCGCAACCACCCAAGGCACAA
TGGCTTTACGACTGGGACTCAATATTGGAGCTCGAGGGTCGAGTTTCTCGCTACCGTGACAGTCTCTGCGACGCC
CTGGAGGAGAGTCGCCGCAGCTCGTCGCCCCGGGCGTGCAGAGTCGGGGTTCCTGCACCCGAACCCGAGCCGACC
TCTCCACTCGGCTTTTTCGGGCTCGACGAGAAGGACATGGAGGCGTGTATGCTGGCGTCGATGGCACAACTGAGT
CGGCCGATGACTGAGCAGGAATCGAAGGATCCGGAGGACGACGTGCTCCGTCGGCGGCTCTTCGACAGCCACGGC
CCGGATTCGGAAGATGCGGGTGCGACGCCGCACTGGTCGCTCTTACCGGTGCTGTCGTTTGGCGGCATCGCGTCG
GCGCAAGGCCAGATTGTCAGTCGTGAGAGTCTCCGGCTTCTGTTCGACGCGCACGACATTGGCAAGCACCTGAGG
CTGCAAAGAGACTTTCACCTGCTCGGCAACGGCATGTTTAGCAGCCGGCTCGCGCAGGCGCTCTTCGATCCGGAC
CTGCATTCGGCAGAGAGGGTGGCCGGCACGGTCCGACAGGGGGGCGTCATGGGGCTGCGTCTGGGAGGACGGGAC
AGTTGGCCCCCGGCCAGCTCGGAGCTGCGCCTGGTCCTGATGGGAGTGCTGAGCGACAGTTACGGCTCGCAGCAG
GAGTCGGGCCGGACGGAGCGACCTGCTCGGGATGGCGATGGCGTGGCCCTGCCCGGCGACCTGAGCTTCGCGGTG
CGCGACCTGTCGACCGAGGAGATCGACAAGTGCATGAACCCGGATTCGCTGGAGGCGCTGGACTTTCTCCGTCTG
TCCTACACGACGCCGCCGGAGCTGTGCGGCATCATCACGCCGATCAACATGACGCACTACGACCGCATCTTCAAG
CTGCTGTTGCGAGTCTTGCGGATGCTGCACGTCGTCAACCAGCACTGCCTCGGCATCAACTCACGGGCCGGCACG
TGGCAAAGCCCGTCCAGCGCGTCGTACCTTTTTGCCCGAGAGGCACACCGTTTCGTGTCGAGCGTGGCCTCGTAC
TTTTTCGACTCGGGCATAGCCGTCCCGTGGCAGACGTTTGAGCAGGGGCTGGCCGAGATGCGGGCCGCGCTCGGG
GACGGCCGAGGGGGGGGGCCGCCGGAGGAGCTCCCGGGCCCCGACAAGCTGCGCGAGCTGCATAGCCGGGTCCTC
GACCGGATCATGTATGCCCTGTTCCTGAAGAAGAGGCAGCGGCCGGTGCTGCAGCTGCTCGAGGATTTGTTCGGC
ACGGTGCTCGAGTATGCCAAATTCGCACGAGGACAGGCCTCGGGCACGGGCGGCGAGAGGGCAGAGGGCCACGAC
AGGGCGTCGGAGCTGTACGGCGACTTCAAGAGGAAGATGCACGTCTTCATGGCGGTCTGTCGCGGCCTGACGGAG
AAGGGCCGGGCGGGCAGCGGGAGGGCCGTCGAGGAGCTGGGCGTCGGCGAGGACAGCATGGTGGCGCAGCTGCTG
GTGAAGCTGGACATGGGCAGCTTCTATACCAAGCGTTGA
Gene >Hirsu2|2622
ATGACCAGGGCCGACGACGAACCGTACGTCTTCGCCATCCCCCAGTTCGGGCAAACGTCGAAATGGCTGGAGCGG
GTGGCCCAAGAGGCGCCGCCCTTCTTCGCCACCAACCCCGGCCCGTTCGCCGTCTCTGCGCCGGGAGAGCCGAGC
TCGGTCGCGTCGGATGAGCCGATCCCGGGCCTGTTGAACTTCAAGCCGATTGCGCCGGACAAGGATGGCTTCTTC
AAGCTCCCTCCGCTCGGCCTCGCCGAGTCCGCGCCCGGGACCGCTGAGCCGGCGCCCCGTCCCGCGGCCGACGAC
TCGAGTGAGGCCGAGGCCACGGGCAGCGACGCGTGGATCGGCACAGAGGAGCCGCCCACGAAGCCGGTGGGCTTC
AGGACATGGGACTCCTTCCGCACCGGAGGTCTCGCGCCGCATCGGCCCCTGCTCATCAGCGAGGCTGGCCCGACC
GCCTACGACGCCTTGCTCCGCCGCACCACGGGTCCGCCAGGGCTCAGCAATTCGGACGTTTCCGTCGTCGAGACC
CGAGCCTACTTCTCTTCCCTGCTGGCCCTGGCCCTCGGCCGAGACTCAGTCTTCTTCCGCAAGGCGGACCACCCC
CAAACCTTCAAGCCCACTCTTGCCAAGATCCGGATCTCGGGCTACTCTCGTCAACTGCTGCAAGGCGTGGAAAGC
CAGACACTTCGCTGTGGCATGTCTTTCTCGCAGCTCAGCGCCTTCGTTCGCACCACCTATGCGACCAAGTCGACT
CGATGTGAGGTGGCTCTTGCCAGCAGCATCGACCAGATCTTGCAGGCCGTGGAGCGCAAGTTGACGGTCACCGGC
ACGAGGCCCCGCTCACTCTTGCAACTCCAATCATCCATCAGGGCCGTCTCGGCAATGCTGCTGCCGCTGAGGAAA
CTCGTTCTGCGTCTGCGGCGGGGAGCCTTGGACGAAGACGTCCTGTCACTACTCTTCCACACGGCATCCGCCCTG
GACGACGGCGAAGGCTGTATCCGATTCGCGTTTCGCCAGATTCTGCGTCGCGTGTCTGCCCCCTGGATCGAGCAT
CTTGAAGAATGGATCGGGACGAGACAAGAAGAGGGCATTCCGCTGTCAAAAACCCACATAGGGGAGGGCAGGGGA
TTTGTCAAGGTAGAGGCAGAGTCGTACGTCGACGACCTCGGTCGGCAAGTGGAGGAAGTCGACTTCCGACTGGAT
CGCAGCAGGGTTCCAGACTTCATGCCGGATGATCTGATCGACTCCATCTTCGAGACAGGTCGGAATCTGCGCTTC
ATCAAGTCCTTCCACCCAGAGCACCCTCTGGCTCAACAATGCGTGGTCGAGTCGTCGCAACCACCCAAGGCACAA
TGGCTTTACGACTGGGACTCAATATTGGAGCTCGAGGGTCGAGTTTCTCGCTACCGTGACAGTCTCTGCGACGCC
CTGGAGGAGAGTCGCCGCAGCTCGTCGCCCCGGGCGTGCAGAGTCGGGGTTCCTGCACCCGAACCCGAGCCGACC
TCTCCACTCGGCTTTTTCGGGCTCGACGAGAAGGACATGGAGGCGTGTATGCTGGCGTCGATGGCACAACTGAGT
CGGCCGATGACTGAGCAGGAATCGAAGGATCCGGAGGACGACGTGCTCCGTCGGCGGCTCTTCGACAGCCACGGC
CCGGATTCGGAAGATGCGGGTGCGACGCCGCACTGGTCGCTCTTACCGGTGCTGTCGTTTGGCGGCATCGCGTCG
GCGCAAGGCCAGATTGTCAGTCGTGAGAGTCTCCGGCTTCTGTTCGACGCGCACGACATTGGCAAGCACCTGAGG
CTGCAAAGAGACTTTCACCTGCTCGGCAACGGCATGTTTAGCAGCCGGCTCGCGCAGGCGCTCTTCGATCCGGAC
CTGCATTCGGCAGAGAGGGTGGCCGGCACGGTCCGACAGGGGGGCGTCATGGGGCTGCGTCTGGGAGGACGGGAC
AGTTGGCCCCCGGCCAGCTCGGAGCTGCGCCTGGTCCTGATGGGAGTGCTGAGCGACAGTTACGGCTCGCAGCAG
GAGTCGGGCCGGACGGAGCGACCTGCTCGGGATGGCGATGGCGTGGCCCTGCCCGGCGACCTGAGCTTCGCGGTG
CGCGACCTGTCGACCGAGGAGATCGACAAGTGCATGAACCCGGATTCGCTGGAGGCGCTGGACTTTCTCCGTCTG
TCCTACACGACGCCGCCGGAGCTGTGCGGCATCATCACGCCGATCAACATGACGCACTACGACCGCATCTTCAAG
CTGCTGTTGCGAGTCTTGCGGATGCTGCACGTCGTCAACCAGCACTGCCTCGGCATCAACTCACGGGCCGGCACG
TGGCAAAGCCCGTCCAGCGCGTCGTACCTTTTTGCCCGAGAGGCACACCGTTTCGTGTCGAGCGTGGCCTCGTAC
TTTTTCGACTCGGGCATAGCCGTCCCGTGGCAGACGTTTGAGCAGGGGCTGGCCGAGATGCGGGCCGCGCTCGGG
GACGGCCGAGGGGGGGGGCCGCCGGAGGAGCTCCCGGGCCCCGACAAGCTGCGCGAGCTGCATAGCCGGGTCCTC
GACCGGATCATGTATGCCCTGTTCCTGAAGAAGAGGCAGCGGCCGGTGCTGCAGCTGCTCGAGGATTTGTTCGGC
ACGGTGCTCGAGTATGCCAAATTCGCACGAGGACAGGCCTCGGGCACGGGCGGCGAGAGGGCAGAGGGCCACGAC
AGGGCGTCGGAGCTGTACGGCGACTTCAAGAGGAAGATGCACGTCTTCATGGCGGTCTGTCGCGGCCTGACGGAG
AAGGGCCGGGCGGGCAGCGGGAGGGCCGTCGAGGAGCTGGGCGTCGGCGAGGACAGCATGGTGGCGCAGCTGCTG
GTGAAGCTGGACATGGGCAGCTTCTATACCAAGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail