Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2615
Gene name
LocationContig_163:25528..30207
Strand+
Gene length (bp)4679
Transcript length (bp)4485
Coding sequence length (bp)4485
Protein length (aa) 1495

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00168 C2 C2 domain 3.3E-17 452 545
PF00168 C2 C2 domain 2.1E-14 595 700
PF00168 C2 C2 domain 4.5E-17 735 823
PF00168 C2 C2 domain 5.3E-22 1095 1191
PF00168 C2 C2 domain 2.2E-01 1352 1436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 77 1266 0.0E+00
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 98 1458 0.0E+00
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 128 1214 3.0E-175
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 89 1275 1.0E-167
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 164 1217 7.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT00|YKH3_SCHPO Uncharacterized protein PYUK71.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPYUK71.03c PE=1 SV=1 77 1266 0.0E+00
sp|Q03640|TCB3_YEAST Tricalbin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB3 PE=1 SV=1 98 1458 0.0E+00
sp|Q12466|TCB1_YEAST Tricalbin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB1 PE=1 SV=1 128 1214 3.0E-175
sp|P48231|TCB2_YEAST Tricalbin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TCB2 PE=1 SV=1 89 1275 1.0E-167
sp|O14065|YC31_SCHPO Uncharacterized protein C962.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC962.01 PE=2 SV=3 164 1217 7.0E-125
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 233 714 5.0E-33
sp|A0JJX5|SYT4_ARATH Synaptotagmin-4 OS=Arabidopsis thaliana GN=SYT4 PE=2 SV=1 232 716 5.0E-30
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 232 719 1.0E-29
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 233 715 2.0E-29
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 176 791 4.0E-29
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 176 791 5.0E-29
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 233 715 4.0E-28
sp|Q5RAG2|ESYT1_PONAB Extended synaptotagmin-1 OS=Pongo abelii GN=ESYT1 PE=2 SV=2 176 792 8.0E-28
sp|Q9BSJ8|ESYT1_HUMAN Extended synaptotagmin-1 OS=Homo sapiens GN=ESYT1 PE=1 SV=1 176 792 1.0E-27
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 213 694 4.0E-16
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 164 688 7.0E-16
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 233 688 3.0E-15
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 175 542 4.0E-15
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 159 535 5.0E-13
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1067 1233 7.0E-13
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1094 1192 4.0E-12
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 1096 1215 5.0E-11
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 1096 1215 5.0E-11
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 1097 1192 2.0E-10
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 1096 1219 2.0E-10
sp|P41823|SY65_APLCA Synaptotagmin-1 OS=Aplysia californica GN=SYT1 PE=1 SV=2 1095 1186 3.0E-10
sp|O35681|SYT3_MOUSE Synaptotagmin-3 OS=Mus musculus GN=Syt3 PE=1 SV=2 1097 1212 3.0E-10
sp|Q9BQG1|SYT3_HUMAN Synaptotagmin-3 OS=Homo sapiens GN=SYT3 PE=2 SV=1 1096 1181 3.0E-10
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1095 1185 4.0E-10
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 1097 1192 6.0E-10
sp|P46097|SYT2_MOUSE Synaptotagmin-2 OS=Mus musculus GN=Syt2 PE=1 SV=1 1096 1199 8.0E-10
sp|Q6DN12|MCTP2_HUMAN Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens GN=MCTP2 PE=1 SV=3 1091 1233 1.0E-09
sp|P24507|SY63_DIPOM Synaptotagmin-C OS=Diplobatis ommata GN=P65-C PE=2 SV=1 1096 1212 1.0E-09
sp|Q5RJH2|MCTP2_MOUSE Multiple C2 and transmembrane domain-containing protein 2 OS=Mus musculus GN=Mctp2 PE=2 SV=1 1091 1200 2.0E-09
sp|Q8N9I0|SYT2_HUMAN Synaptotagmin-2 OS=Homo sapiens GN=SYT2 PE=1 SV=2 1096 1199 2.0E-09
sp|P29101|SYT2_RAT Synaptotagmin-2 OS=Rattus norvegicus GN=Syt2 PE=1 SV=1 1096 1199 2.0E-09
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 233 544 2.0E-09
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 233 544 4.0E-09
sp|B6ETT4|SYT2_ARATH Synaptotagmin-2 OS=Arabidopsis thaliana GN=SYT2 PE=2 SV=1 1085 1190 5.0E-09
sp|Q9Z1X1|ESYT1_RAT Extended synaptotagmin-1 OS=Rattus norvegicus GN=Esyt1 PE=1 SV=1 452 713 6.0E-09
sp|P24506|SY62_DIPOM Synaptotagmin-B OS=Diplobatis ommata GN=P65-B PE=1 SV=1 1096 1186 6.0E-09
sp|Q86SS6|SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens GN=SYT9 PE=2 SV=1 604 817 7.0E-09
sp|Q7ZWU7|EST2B_XENLA Extended synaptotagmin-2-B OS=Xenopus laevis GN=esyt2-b PE=2 SV=1 1095 1208 8.0E-09
sp|Q5M7N9|ESYT3_XENTR Extended synaptotagmin-3 OS=Xenopus tropicalis GN=esyt3 PE=2 SV=1 1095 1208 9.0E-09
sp|Q9R0N9|SYT9_MOUSE Synaptotagmin-9 OS=Mus musculus GN=Syt9 PE=1 SV=2 604 817 9.0E-09
sp|Q925C0|SYT9_RAT Synaptotagmin-9 OS=Rattus norvegicus GN=Syt9 PE=1 SV=1 604 817 9.0E-09
sp|A0A075F932|SYT1_ANSCY Synaptotagmin-1 OS=Anser cygnoid GN=SYT1 PE=2 SV=1 1096 1186 1.0E-08
sp|Q5FWL4|EST2A_XENLA Extended synaptotagmin-2-A OS=Xenopus laevis GN=esyt2-a PE=2 SV=1 1095 1208 2.0E-08
sp|P47191|SYT1_CHICK Synaptotagmin-1 OS=Gallus gallus GN=SYT1 PE=2 SV=1 1095 1186 2.0E-08
sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 PE=1 SV=1 157 544 2.0E-08
sp|P24505|SY61_DIPOM Synaptotagmin-A OS=Diplobatis ommata GN=P65-A PE=2 SV=1 1096 1186 4.0E-08
sp|Q3TZZ7|ESYT2_MOUSE Extended synaptotagmin-2 OS=Mus musculus GN=Esyt2 PE=1 SV=1 1095 1198 7.0E-08
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 1095 1186 7.0E-08
sp|P48018|SYT1_BOVIN Synaptotagmin-1 OS=Bos taurus GN=SYT1 PE=1 SV=1 1096 1186 7.0E-08
sp|P21579|SYT1_HUMAN Synaptotagmin-1 OS=Homo sapiens GN=SYT1 PE=1 SV=1 1096 1186 7.0E-08
sp|P21707|SYT1_RAT Synaptotagmin-1 OS=Rattus norvegicus GN=Syt1 PE=1 SV=3 1096 1186 7.0E-08
sp|P46096|SYT1_MOUSE Synaptotagmin-1 OS=Mus musculus GN=Syt1 PE=1 SV=1 1096 1186 7.0E-08
sp|Q60HC0|SYT1_MACFA Synaptotagmin-1 OS=Macaca fascicularis GN=SYT1 PE=2 SV=1 1096 1186 8.0E-08
sp|A0FGR9|ESYT3_HUMAN Extended synaptotagmin-3 OS=Homo sapiens GN=ESYT3 PE=1 SV=1 1079 1208 9.0E-08
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 1094 1187 1.0E-07
sp|A0FGR8|ESYT2_HUMAN Extended synaptotagmin-2 OS=Homo sapiens GN=ESYT2 PE=1 SV=1 1095 1208 1.0E-07
sp|Q7XA06|SYT3_ARATH Synaptotagmin-3 OS=Arabidopsis thaliana GN=SYT3 PE=2 SV=1 707 892 2.0E-07
sp|Q3U7R1|ESYT1_MOUSE Extended synaptotagmin-1 OS=Mus musculus GN=Esyt1 PE=1 SV=2 452 713 2.0E-07
sp|Q5DTI8|ESYT3_MOUSE Extended synaptotagmin-3 OS=Mus musculus GN=Esyt3 PE=2 SV=2 1079 1208 2.0E-07
sp|Q86KB1|ADCB_DICDI Arrestin domain-containing protein B OS=Dictyostelium discoideum GN=adcB PE=3 SV=1 1097 1214 2.0E-07
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 734 900 2.0E-07
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 734 900 3.0E-07
sp|P21521|SY65_DROME Synaptotagmin 1 OS=Drosophila melanogaster GN=Syt1 PE=1 SV=3 1093 1186 3.0E-07
sp|Q93XX4|C2D61_ARATH C2 domain-containing protein At1g53590 OS=Arabidopsis thaliana GN=NTMC2T6.1 PE=1 SV=2 1094 1185 4.0E-07
sp|Q86SS6|SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens GN=SYT9 PE=2 SV=1 1062 1181 4.0E-07
sp|P40748|SYT3_RAT Synaptotagmin-3 OS=Rattus norvegicus GN=Syt3 PE=1 SV=1 592 839 6.0E-07
sp|Q9S7J9|CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9 OS=Arabidopsis thaliana GN=CAR9 PE=2 SV=1 731 824 6.0E-07
sp|P34693|SYT1_CAEEL Synaptotagmin-1 OS=Caenorhabditis elegans GN=snt-1 PE=2 SV=1 1095 1186 6.0E-07
sp|Q6DN14|MCTP1_HUMAN Multiple C2 and transmembrane domain-containing protein 1 OS=Homo sapiens GN=MCTP1 PE=2 SV=2 1077 1222 7.0E-07
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 734 900 7.0E-07
sp|P41885|RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans GN=rbf-1 PE=1 SV=2 1039 1186 7.0E-07
sp|Q5R4J5|SYT1_PONAB Synaptotagmin-1 OS=Pongo abelii GN=SYT1 PE=2 SV=1 1070 1184 1.0E-06
sp|Q14183|DOC2A_HUMAN Double C2-like domain-containing protein alpha OS=Homo sapiens GN=DOC2A PE=1 SV=5 1097 1194 1.0E-06
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 1062 1180 1.0E-06
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 1062 1176 1.0E-06
sp|Q14184|DOC2B_HUMAN Double C2-like domain-containing protein beta OS=Homo sapiens GN=DOC2B PE=1 SV=1 447 708 1.0E-06
sp|Q9SKR2|SYT1_ARATH Synaptotagmin-1 OS=Arabidopsis thaliana GN=SYT1 PE=1 SV=2 1079 1212 2.0E-06
sp|Q5RBF2|NED4L_PONAB E3 ubiquitin-protein ligase NEDD4-like OS=Pongo abelii GN=NEDD4L PE=2 SV=1 1097 1211 2.0E-06
sp|Q8CFI0|NED4L_MOUSE E3 ubiquitin-protein ligase NEDD4-like OS=Mus musculus GN=Nedd4l PE=1 SV=2 1097 1211 2.0E-06
sp|Q96PU5|NED4L_HUMAN E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens GN=NEDD4L PE=1 SV=2 1097 1211 2.0E-06
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 1088 1182 2.0E-06
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 1088 1182 2.0E-06
sp|Q9VVI3|NEDD4_DROME E3 ubiquitin-protein ligase Nedd-4 OS=Drosophila melanogaster GN=Nedd4 PE=1 SV=2 751 908 2.0E-06
sp|Q9LP65|CAR5_ARATH Protein C2-DOMAIN ABA-RELATED 5 OS=Arabidopsis thaliana GN=CAR5 PE=2 SV=1 1084 1204 2.0E-06
sp|O00445|SYT5_HUMAN Synaptotagmin-5 OS=Homo sapiens GN=SYT5 PE=2 SV=2 1095 1193 2.0E-06
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1097 1185 3.0E-06
sp|Q9S7J9|CAR9_ARATH Protein C2-DOMAIN ABA-RELATED 9 OS=Arabidopsis thaliana GN=CAR9 PE=2 SV=1 447 549 3.0E-06
sp|Q14184|DOC2B_HUMAN Double C2-like domain-containing protein beta OS=Homo sapiens GN=DOC2B PE=1 SV=1 1039 1184 3.0E-06
sp|Q8L7A4|AGD11_ARATH Probable ADP-ribosylation factor GTPase-activating protein AGD11 OS=Arabidopsis thaliana GN=AGD11 PE=2 SV=1 1094 1185 3.0E-06
sp|P70610|DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus GN=Doc2b PE=1 SV=2 1039 1184 3.0E-06
sp|P41885|RBF1_CAEEL Rabphilin-1 OS=Caenorhabditis elegans GN=rbf-1 PE=1 SV=2 597 820 4.0E-06
sp|Q9FIK8|CAR11_ARATH Protein C2-DOMAIN ABA-RELATED 11 OS=Arabidopsis thaliana GN=CAR11 PE=1 SV=1 1094 1236 4.0E-06
sp|Q9C6B7|CAR3_ARATH Protein C2-DOMAIN ABA-RELATED 3 OS=Arabidopsis thaliana GN=CAR3 PE=3 SV=1 1092 1183 6.0E-06
sp|P70169|DOC2B_MOUSE Double C2-like domain-containing protein beta OS=Mus musculus GN=Doc2b PE=1 SV=2 1039 1184 6.0E-06
sp|Q8L706|SYT5_ARATH Synaptotagmin-5 OS=Arabidopsis thaliana GN=SYT5 PE=2 SV=1 1094 1212 7.0E-06
sp|Q9LVH4|CAR4_ARATH Protein C2-DOMAIN ABA-RELATED 4 OS=Arabidopsis thaliana GN=CAR4 PE=1 SV=1 732 860 7.0E-06
sp|Q9C8Y2|CAR2_ARATH Protein C2-DOMAIN ABA-RELATED 2 OS=Arabidopsis thaliana GN=CAR2 PE=3 SV=1 1092 1188 8.0E-06
sp|Q9ZVT9|C2GR1_ARATH C2 and GRAM domain-containing protein At1g03370 OS=Arabidopsis thaliana GN=At1g03370 PE=2 SV=4 1096 1182 8.0E-06
sp|P70610|DOC2B_RAT Double C2-like domain-containing protein beta OS=Rattus norvegicus GN=Doc2b PE=1 SV=2 447 708 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 183 205 22
2 717 739 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2615
MSALEESELKAQGAIEAAEDPESLVTADDAEREIVELSRNAGVAAFNFDPDATPEQKRAQARAAIPVELQQSRRE
KGAAIITDQDDGTGPDEDLPEPSKAGVLDVAVDADGKRLADGTDPDEEEAPFSRTGWAPRMGWPINSSMEDESLL
DHATWVEGKLPDHLYGDWYHNAALIVFACLSSWLVAVLGGGLGWVALIMAVCATYYRTSLRRVRRNFRDDITREL
ALKKLENDNESLEWINSFLVKFWPIYQPVLAQTIINSVDQVLSSATPAFLDSLKLKTFTLGSKPPRMEHVKTYPK
TEDDIVMMDWKFSFTPNDTADMTARQIKNKINPKVVLEIRIGKAMISKGLDVIVEDMSFSGIMRLRIKLQIPFPH
VDRIEMCFLERPTIDYVCKPLGGDNFGFDINFIPGLETFILEQIHGNLAPMMYAPNVFPIEVAKMLAGTPVDQAV
GVLALTLHGAQGLKNSDNFGGTIDPYACISFSRRQELARTKTIEDNPNPRWNETHYLIVTSFNDTLDIQVFDKND
FRKSKELGVASFHLEDIEDLHVFENERLEVISDGKARGIVSCDLRFFPVLEAKKLPDGKTTEPPPPSNQGILRFT
IEQAKDLDGTKSLVGLLNPYAVMFLNGKTVHQTKKLKRTNNPIWDNGSKEILITDRKRAKLGVTIKDDRDLTGDQ
TLGKYQIRLDEMLDCMEQGKEWYQLSGAQSGRVKMMAQWRPVAITGVAGTGGYLTPIGVMRFHFKRATDLRNFEA
FGKSDPYVRVLLSGIDKARTVTFRNDLNPEWDEVLYVPIHSARDRLTLEVMDAEKMGKDRSLGLVELSAADYVQQ
ADNGEYLVDERKVVRDEGLRLHGKGIAKGTLTYTASFYPCLNIADPEEEEEGEEGTEKGAEKASEDDKEQEASED
AAKSSEQPRTSVERSSQAGKFKASLDKDGEERPRSSHSTAGRPSVEDHGPPKIRLSPEELLKYESGLLIFRLLEG
EMPESHCRLEVFVDDMAYASYVSSTSSAKTHKFDEIGDCVIRELDVSRLTLKARKKGDDNDHTLAQLAGNTMETL
KQCLNNPTKLKLRTDDGRDGWVKVSLKYIPIKMQLDPSESINNMGRLRVDILDGVDLPSADRNGKSDPYCKFELN
GHEVYKTKVQKKTLSPVWNEFFEVSVPSRTAADFIVNVYDYDFADKPDFLGSAVINLESLDPFKPSESRYILDGK
SGSVRIRMLFRPDYVTRTVQGSSTFSSGPGRIVTGVAGAPIKGGAAVAGAVGHGVGRGASFLRRGIFGKKDGDDT
NGSLPEGLEGPIATSNGGDPAGGSSRRRSANHGDAVAVPTIEQPISRNNSMSHSRSKSITASSMHSVSPGGGATG
TATFTVVGATGYPASTDLYIVITQMSPREKVVGKTKHHKSSTEEWSFNETFSARCSSDAQFKIEAKGDHFIGSDD
DLGEHVYFVDETGAAAPKELSVGGGTVTIKSNFQPTESNAPDTPRSHNLRRSFLGKREGRSSREATPNP*
Coding >Hirsu2|2615
ATGTCTGCCCTCGAGGAAAGCGAGCTCAAGGCTCAAGGCGCCATTGAGGCGGCTGAGGACCCCGAGAGCCTGGTG
ACGGCCGACGATGCGGAGCGGGAAATCGTCGAGCTGTCCAGGAACGCCGGCGTCGCCGCCTTCAATTTCGATCCC
GATGCCACGCCAGAGCAGAAGCGCGCCCAGGCGCGTGCGGCCATCCCCGTCGAGCTCCAGCAGAGCAGGCGCGAG
AAGGGCGCTGCCATCATCACCGACCAAGATGACGGCACCGGCCCGGACGAGGACCTCCCCGAGCCCAGCAAGGCC
GGCGTGCTAGACGTCGCCGTCGACGCCGACGGCAAGCGCCTCGCCGACGGCACCGACCCCGACGAGGAGGAGGCG
CCTTTCTCGCGCACCGGCTGGGCCCCTCGCATGGGCTGGCCCATCAACAGCTCCATGGAGGACGAGAGCCTGCTC
GACCACGCCACCTGGGTCGAGGGCAAGCTTCCCGATCACCTCTACGGAGATTGGTACCACAACGCCGCCCTCATC
GTCTTTGCCTGCCTCTCCTCCTGGCTTGTCGCCGTCCTCGGCGGCGGCCTGGGCTGGGTCGCCCTCATCATGGCC
GTCTGCGCCACCTACTACCGGACCTCTCTCCGCCGCGTGCGCCGCAACTTCCGCGACGACATCACCCGCGAACTG
GCCCTCAAGAAGCTCGAAAACGACAACGAGTCGCTCGAGTGGATCAATTCGTTCCTCGTCAAGTTCTGGCCCATC
TACCAGCCCGTCCTCGCTCAGACCATCATCAACTCCGTCGATCAGGTCCTCAGCTCCGCCACGCCCGCCTTCCTC
GACAGCCTTAAGCTCAAGACCTTCACCCTCGGCTCCAAGCCTCCGCGCATGGAGCACGTCAAGACGTACCCCAAG
ACCGAGGACGACATCGTCATGATGGACTGGAAGTTCAGCTTCACCCCCAACGACACGGCCGACATGACGGCCCGC
CAGATCAAGAACAAGATCAATCCCAAGGTCGTCTTGGAGATTCGCATCGGCAAGGCCATGATCAGCAAGGGCCTC
GACGTCATCGTCGAGGACATGTCCTTCTCCGGCATCATGCGGCTCCGGATCAAGCTCCAGATCCCCTTCCCCCAC
GTCGACAGGATCGAGATGTGCTTCCTCGAGCGGCCCACCATCGACTACGTCTGCAAGCCCCTGGGCGGCGACAAC
TTTGGCTTCGACATCAACTTCATCCCGGGGCTCGAGACCTTCATCCTCGAGCAGATCCACGGCAACCTGGCCCCC
ATGATGTACGCGCCCAACGTCTTCCCCATCGAGGTCGCCAAGATGCTGGCCGGCACGCCCGTCGACCAGGCCGTC
GGCGTCCTCGCCCTGACTCTCCACGGGGCACAGGGTCTCAAGAACAGCGACAACTTCGGCGGCACCATCGACCCC
TACGCCTGCATCAGCTTCAGCCGACGTCAGGAGCTCGCGAGGACCAAGACGATCGAGGACAACCCCAACCCCAGG
TGGAACGAGACGCACTATCTCATCGTCACCTCCTTCAACGACACCCTCGACATTCAGGTCTTCGACAAGAACGAC
TTCCGAAAGTCAAAGGAGCTCGGCGTGGCTTCCTTCCATCTGGAAGACATCGAAGACCTGCACGTGTTCGAAAAT
GAGCGCCTCGAGGTCATCTCCGACGGCAAGGCCCGCGGCATCGTCTCCTGCGACCTCCGCTTCTTCCCGGTCCTG
GAGGCGAAGAAGCTCCCCGACGGCAAGACGACGGAGCCCCCGCCGCCGTCCAACCAGGGCATCCTGCGCTTCACC
ATCGAGCAGGCCAAGGACTTGGACGGCACCAAGAGTCTCGTCGGCCTCCTCAACCCTTACGCCGTCATGTTCCTC
AACGGCAAGACCGTCCACCAGACCAAGAAGCTCAAGCGCACAAACAACCCCATCTGGGACAACGGCTCCAAGGAG
ATACTCATCACCGACCGCAAGAGGGCCAAGCTCGGCGTCACCATCAAGGACGACCGGGACCTTACCGGAGACCAG
ACTCTGGGCAAGTATCAGATCAGGCTGGACGAGATGCTCGACTGCATGGAGCAGGGCAAGGAGTGGTATCAGCTG
TCCGGGGCCCAGTCCGGTCGCGTCAAGATGATGGCCCAGTGGAGACCGGTCGCCATCACCGGTGTGGCCGGCACC
GGCGGTTACCTCACCCCCATCGGCGTCATGCGATTCCACTTCAAGAGGGCGACCGACCTGCGCAACTTCGAGGCC
TTTGGAAAGTCGGATCCGTACGTCCGGGTGCTGCTGTCCGGCATCGACAAGGCTCGAACGGTCACCTTCAGGAAC
GATCTGAACCCCGAGTGGGACGAGGTGCTTTACGTACCCATCCACTCCGCGCGCGACAGGCTCACCCTGGAGGTC
ATGGATGCCGAGAAGATGGGCAAGGATCGCAGCCTCGGCCTTGTCGAGCTGTCTGCCGCCGACTACGTGCAGCAG
GCCGACAACGGCGAATATCTCGTCGACGAAAGGAAGGTTGTCCGAGACGAGGGCCTCCGCCTCCACGGCAAGGGC
ATCGCCAAGGGTACCCTGACTTATACTGCTTCATTCTACCCCTGTCTCAACATCGCAGATCCCGAGGAGGAGGAG
GAGGGTGAGGAGGGCACGGAGAAGGGGGCCGAAAAGGCGTCGGAGGACGATAAAGAGCAGGAAGCCTCGGAAGAC
GCCGCGAAGAGCAGCGAGCAGCCGAGGACGTCGGTCGAGCGATCGTCACAAGCCGGCAAGTTCAAGGCCAGCCTG
GATAAGGACGGCGAGGAGCGGCCAAGGAGCTCGCACTCGACTGCGGGGCGACCGTCGGTCGAGGACCACGGGCCC
CCCAAAATCCGACTCAGCCCCGAGGAGCTCCTCAAGTACGAGAGCGGACTGCTCATCTTCCGCCTGCTGGAGGGC
GAGATGCCGGAGAGCCACTGCCGGCTGGAGGTGTTCGTCGACGACATGGCCTACGCGTCTTACGTTTCCTCGACG
TCGTCGGCAAAGACACACAAGTTCGACGAGATCGGTGACTGTGTCATCCGCGAACTCGACGTCTCGCGGCTGACG
CTCAAGGCGCGAAAGAAGGGCGACGACAACGACCACACTCTCGCCCAGCTGGCGGGCAACACTATGGAGACGCTC
AAGCAGTGCCTGAACAACCCGACGAAGCTCAAGCTGAGGACCGACGACGGCCGAGACGGGTGGGTCAAGGTCAGC
CTCAAGTACATCCCCATCAAGATGCAGCTGGATCCGAGCGAGAGCATCAACAACATGGGGAGGCTTCGGGTGGAC
ATCCTGGACGGCGTCGACCTGCCCTCAGCGGACCGGAACGGGAAGAGCGACCCGTACTGCAAGTTCGAGCTCAAC
GGCCACGAAGTCTACAAGACAAAGGTGCAGAAGAAGACGCTGTCGCCCGTGTGGAACGAGTTCTTCGAGGTCAGC
GTGCCGTCGCGGACGGCGGCCGACTTCATCGTCAACGTCTACGATTACGACTTTGCTGACAAACCCGACTTTCTC
GGGTCCGCCGTCATCAACCTCGAGTCGCTCGACCCCTTTAAGCCGTCCGAGTCGCGGTACATCCTGGACGGCAAG
TCGGGCAGCGTGCGCATCCGGATGCTCTTCCGGCCGGACTACGTCACGCGGACCGTGCAGGGTTCGTCCACGTTC
TCTTCCGGCCCCGGTAGGATCGTTACTGGCGTGGCCGGAGCGCCCATCAAGGGCGGCGCCGCCGTGGCCGGGGCG
GTGGGACATGGCGTCGGCCGGGGAGCCTCGTTTCTCCGCCGCGGAATCTTCGGCAAGAAGGACGGGGATGACACC
AACGGGTCGCTGCCCGAGGGCCTGGAGGGGCCCATCGCGACCAGCAACGGCGGCGACCCGGCGGGCGGCAGCAGC
CGGCGGCGGTCGGCGAACCACGGCGACGCCGTGGCCGTGCCGACGATAGAGCAGCCCATATCGCGCAACAACTCG
ATGAGCCACAGTCGAAGCAAGAGCATCACGGCGTCGTCGATGCACAGCGTCAGCCCAGGCGGCGGTGCGACGGGC
ACGGCGACGTTCACGGTGGTGGGTGCCACGGGTTACCCGGCCTCGACCGACCTCTACATTGTCATCACCCAAATG
TCGCCGAGGGAGAAGGTGGTGGGCAAGACGAAGCACCACAAGTCGTCGACGGAGGAGTGGAGCTTCAACGAGACG
TTCAGCGCCCGGTGCAGCTCGGATGCGCAGTTCAAGATCGAGGCCAAGGGCGACCACTTCATCGGCAGCGACGAC
GACCTCGGCGAGCACGTCTACTTTGTGGACGAGACGGGGGCAGCCGCTCCCAAGGAGCTGAGCGTCGGCGGCGGG
ACGGTGACCATCAAGAGCAACTTCCAGCCGACCGAATCGAACGCGCCGGACACGCCGCGGTCGCACAACCTGCGG
CGCAGCTTCCTGGGCAAGCGGGAGGGCCGCTCGAGCAGGGAGGCGACGCCGAACCCATAG
Transcript >Hirsu2|2615
ATGTCTGCCCTCGAGGAAAGCGAGCTCAAGGCTCAAGGCGCCATTGAGGCGGCTGAGGACCCCGAGAGCCTGGTG
ACGGCCGACGATGCGGAGCGGGAAATCGTCGAGCTGTCCAGGAACGCCGGCGTCGCCGCCTTCAATTTCGATCCC
GATGCCACGCCAGAGCAGAAGCGCGCCCAGGCGCGTGCGGCCATCCCCGTCGAGCTCCAGCAGAGCAGGCGCGAG
AAGGGCGCTGCCATCATCACCGACCAAGATGACGGCACCGGCCCGGACGAGGACCTCCCCGAGCCCAGCAAGGCC
GGCGTGCTAGACGTCGCCGTCGACGCCGACGGCAAGCGCCTCGCCGACGGCACCGACCCCGACGAGGAGGAGGCG
CCTTTCTCGCGCACCGGCTGGGCCCCTCGCATGGGCTGGCCCATCAACAGCTCCATGGAGGACGAGAGCCTGCTC
GACCACGCCACCTGGGTCGAGGGCAAGCTTCCCGATCACCTCTACGGAGATTGGTACCACAACGCCGCCCTCATC
GTCTTTGCCTGCCTCTCCTCCTGGCTTGTCGCCGTCCTCGGCGGCGGCCTGGGCTGGGTCGCCCTCATCATGGCC
GTCTGCGCCACCTACTACCGGACCTCTCTCCGCCGCGTGCGCCGCAACTTCCGCGACGACATCACCCGCGAACTG
GCCCTCAAGAAGCTCGAAAACGACAACGAGTCGCTCGAGTGGATCAATTCGTTCCTCGTCAAGTTCTGGCCCATC
TACCAGCCCGTCCTCGCTCAGACCATCATCAACTCCGTCGATCAGGTCCTCAGCTCCGCCACGCCCGCCTTCCTC
GACAGCCTTAAGCTCAAGACCTTCACCCTCGGCTCCAAGCCTCCGCGCATGGAGCACGTCAAGACGTACCCCAAG
ACCGAGGACGACATCGTCATGATGGACTGGAAGTTCAGCTTCACCCCCAACGACACGGCCGACATGACGGCCCGC
CAGATCAAGAACAAGATCAATCCCAAGGTCGTCTTGGAGATTCGCATCGGCAAGGCCATGATCAGCAAGGGCCTC
GACGTCATCGTCGAGGACATGTCCTTCTCCGGCATCATGCGGCTCCGGATCAAGCTCCAGATCCCCTTCCCCCAC
GTCGACAGGATCGAGATGTGCTTCCTCGAGCGGCCCACCATCGACTACGTCTGCAAGCCCCTGGGCGGCGACAAC
TTTGGCTTCGACATCAACTTCATCCCGGGGCTCGAGACCTTCATCCTCGAGCAGATCCACGGCAACCTGGCCCCC
ATGATGTACGCGCCCAACGTCTTCCCCATCGAGGTCGCCAAGATGCTGGCCGGCACGCCCGTCGACCAGGCCGTC
GGCGTCCTCGCCCTGACTCTCCACGGGGCACAGGGTCTCAAGAACAGCGACAACTTCGGCGGCACCATCGACCCC
TACGCCTGCATCAGCTTCAGCCGACGTCAGGAGCTCGCGAGGACCAAGACGATCGAGGACAACCCCAACCCCAGG
TGGAACGAGACGCACTATCTCATCGTCACCTCCTTCAACGACACCCTCGACATTCAGGTCTTCGACAAGAACGAC
TTCCGAAAGTCAAAGGAGCTCGGCGTGGCTTCCTTCCATCTGGAAGACATCGAAGACCTGCACGTGTTCGAAAAT
GAGCGCCTCGAGGTCATCTCCGACGGCAAGGCCCGCGGCATCGTCTCCTGCGACCTCCGCTTCTTCCCGGTCCTG
GAGGCGAAGAAGCTCCCCGACGGCAAGACGACGGAGCCCCCGCCGCCGTCCAACCAGGGCATCCTGCGCTTCACC
ATCGAGCAGGCCAAGGACTTGGACGGCACCAAGAGTCTCGTCGGCCTCCTCAACCCTTACGCCGTCATGTTCCTC
AACGGCAAGACCGTCCACCAGACCAAGAAGCTCAAGCGCACAAACAACCCCATCTGGGACAACGGCTCCAAGGAG
ATACTCATCACCGACCGCAAGAGGGCCAAGCTCGGCGTCACCATCAAGGACGACCGGGACCTTACCGGAGACCAG
ACTCTGGGCAAGTATCAGATCAGGCTGGACGAGATGCTCGACTGCATGGAGCAGGGCAAGGAGTGGTATCAGCTG
TCCGGGGCCCAGTCCGGTCGCGTCAAGATGATGGCCCAGTGGAGACCGGTCGCCATCACCGGTGTGGCCGGCACC
GGCGGTTACCTCACCCCCATCGGCGTCATGCGATTCCACTTCAAGAGGGCGACCGACCTGCGCAACTTCGAGGCC
TTTGGAAAGTCGGATCCGTACGTCCGGGTGCTGCTGTCCGGCATCGACAAGGCTCGAACGGTCACCTTCAGGAAC
GATCTGAACCCCGAGTGGGACGAGGTGCTTTACGTACCCATCCACTCCGCGCGCGACAGGCTCACCCTGGAGGTC
ATGGATGCCGAGAAGATGGGCAAGGATCGCAGCCTCGGCCTTGTCGAGCTGTCTGCCGCCGACTACGTGCAGCAG
GCCGACAACGGCGAATATCTCGTCGACGAAAGGAAGGTTGTCCGAGACGAGGGCCTCCGCCTCCACGGCAAGGGC
ATCGCCAAGGGTACCCTGACTTATACTGCTTCATTCTACCCCTGTCTCAACATCGCAGATCCCGAGGAGGAGGAG
GAGGGTGAGGAGGGCACGGAGAAGGGGGCCGAAAAGGCGTCGGAGGACGATAAAGAGCAGGAAGCCTCGGAAGAC
GCCGCGAAGAGCAGCGAGCAGCCGAGGACGTCGGTCGAGCGATCGTCACAAGCCGGCAAGTTCAAGGCCAGCCTG
GATAAGGACGGCGAGGAGCGGCCAAGGAGCTCGCACTCGACTGCGGGGCGACCGTCGGTCGAGGACCACGGGCCC
CCCAAAATCCGACTCAGCCCCGAGGAGCTCCTCAAGTACGAGAGCGGACTGCTCATCTTCCGCCTGCTGGAGGGC
GAGATGCCGGAGAGCCACTGCCGGCTGGAGGTGTTCGTCGACGACATGGCCTACGCGTCTTACGTTTCCTCGACG
TCGTCGGCAAAGACACACAAGTTCGACGAGATCGGTGACTGTGTCATCCGCGAACTCGACGTCTCGCGGCTGACG
CTCAAGGCGCGAAAGAAGGGCGACGACAACGACCACACTCTCGCCCAGCTGGCGGGCAACACTATGGAGACGCTC
AAGCAGTGCCTGAACAACCCGACGAAGCTCAAGCTGAGGACCGACGACGGCCGAGACGGGTGGGTCAAGGTCAGC
CTCAAGTACATCCCCATCAAGATGCAGCTGGATCCGAGCGAGAGCATCAACAACATGGGGAGGCTTCGGGTGGAC
ATCCTGGACGGCGTCGACCTGCCCTCAGCGGACCGGAACGGGAAGAGCGACCCGTACTGCAAGTTCGAGCTCAAC
GGCCACGAAGTCTACAAGACAAAGGTGCAGAAGAAGACGCTGTCGCCCGTGTGGAACGAGTTCTTCGAGGTCAGC
GTGCCGTCGCGGACGGCGGCCGACTTCATCGTCAACGTCTACGATTACGACTTTGCTGACAAACCCGACTTTCTC
GGGTCCGCCGTCATCAACCTCGAGTCGCTCGACCCCTTTAAGCCGTCCGAGTCGCGGTACATCCTGGACGGCAAG
TCGGGCAGCGTGCGCATCCGGATGCTCTTCCGGCCGGACTACGTCACGCGGACCGTGCAGGGTTCGTCCACGTTC
TCTTCCGGCCCCGGTAGGATCGTTACTGGCGTGGCCGGAGCGCCCATCAAGGGCGGCGCCGCCGTGGCCGGGGCG
GTGGGACATGGCGTCGGCCGGGGAGCCTCGTTTCTCCGCCGCGGAATCTTCGGCAAGAAGGACGGGGATGACACC
AACGGGTCGCTGCCCGAGGGCCTGGAGGGGCCCATCGCGACCAGCAACGGCGGCGACCCGGCGGGCGGCAGCAGC
CGGCGGCGGTCGGCGAACCACGGCGACGCCGTGGCCGTGCCGACGATAGAGCAGCCCATATCGCGCAACAACTCG
ATGAGCCACAGTCGAAGCAAGAGCATCACGGCGTCGTCGATGCACAGCGTCAGCCCAGGCGGCGGTGCGACGGGC
ACGGCGACGTTCACGGTGGTGGGTGCCACGGGTTACCCGGCCTCGACCGACCTCTACATTGTCATCACCCAAATG
TCGCCGAGGGAGAAGGTGGTGGGCAAGACGAAGCACCACAAGTCGTCGACGGAGGAGTGGAGCTTCAACGAGACG
TTCAGCGCCCGGTGCAGCTCGGATGCGCAGTTCAAGATCGAGGCCAAGGGCGACCACTTCATCGGCAGCGACGAC
GACCTCGGCGAGCACGTCTACTTTGTGGACGAGACGGGGGCAGCCGCTCCCAAGGAGCTGAGCGTCGGCGGCGGG
ACGGTGACCATCAAGAGCAACTTCCAGCCGACCGAATCGAACGCGCCGGACACGCCGCGGTCGCACAACCTGCGG
CGCAGCTTCCTGGGCAAGCGGGAGGGCCGCTCGAGCAGGGAGGCGACGCCGAACCCATAG
Gene >Hirsu2|2615
ATGTCTGCCCTCGAGGAAAGCGAGCTCAAGGCTCAAGGCGCCATTGAGGCGGCTGAGGACCCCGAGAGCCTGGTG
ACGGCCGACGATGCGGAGCGGGAAATCGTCGAGCTGTCCAGGAACGCCGGCGTCGCCGCCTTCAATTTCGATCCC
GATGCCACGCCAGAGCAGAAGCGCGCCCAGGCGCGTGCGGTACGCCCAAGGCCCGCCCGCCCTCCGCGACGACGA
CCTCGCTTGCTAACCGCCGCCCGCAACCCCCCCAGGCCATCCCCGTCGAGCTCCAGCAGAGCAGGCGCGAGAAGG
GCGCTGCCATCATCACCGACCAAGATGACGGCACCGGCCCGGACGAGGACCTCCCCGAGCCCAGCAAGGCCGGCG
TGCTAGACGTCGCCGTCGACGCCGACGGCAAGCGCCTCGCCGACGGCACCGACCCCGACGAGGAGGAGGCGCCTT
TCTCGCGCACCGGCTGGGCCCCTCGCATGGGCTGGCCCATCAACAGCTCCATGGAGGACGAGAGCCTGCTCGACC
ACGCCACCTGGGTCGAGGGCAAGCTTCCCGATCACCTCTACGGAGGCGAGTCTCCCTCCCGGCGCCCGCCGCTTC
CGACGCTGACCCGTCCACCCAGATTGGTACCACAACGCCGCCCTCATCGTCTTTGCCTGCCTCTCCTCCTGGCTT
GTCGCCGTCCTCGGCGGCGGCCTGGGCTGGGTCGCCCTCATCATGGCCGTCTGCGCCACCTACTACCGGACCTCT
CTCCGCCGCGTGCGCCGCAACTTCCGCGACGACATCACCCGCGAACTGGCCCTCAAGAAGCTCGAAAACGACAAC
GAGTCGCTCGAGTGGATCAATTCGTTCCTCGTCAAGTTCTGGCCCATCTACCAGCCCGTCCTCGCTCAGACCATC
ATCAACTCCGTCGATCAGGTCCTCAGCTCCGCCACGCCCGCCTTCCTCGACAGCCTTAAGCTCAAGACCTTCACC
CTCGGCTCCAAGCCTCCGCGCATGGAGCACGTCAAGACGTACCCCAAGACCGAGGACGACATCGTCATGATGGAC
TGGAAGTTCAGCTTCACCCCCAACGACACGGCCGACATGACGGCCCGCCAGATCAAGAACAAGATCAATCCCAAG
GTCGTCTTGGAGATTCGCATCGGCAAGGCCATGATCAGCAAGGGCCTCGACGTCATCGTCGAGGACATGTCCTTC
TCCGGCATCATGCGGCTCCGGATCAAGCTCCAGATCCCCTTCCCCCACGTCGACAGGATCGAGATGTGCTTCCTC
GAGCGGCCCACCATCGACTACGTCTGCAAGCCCCTGGGCGGCGACAACTTTGGCTTCGACATCAACTTCATCCCG
GGGCTCGAGACCTTCATCCTCGAGCAGATCCACGGCAACCTGGCCCCCATGATGTACGCGCCCAACGTCTTCCCC
ATCGAGGTCGCCAAGATGCTGGCCGGCACGCCCGTCGACCAGGCCGTCGGCGTCCTCGCCCTGACTCTCCACGGG
GCACAGGGTCTCAAGAACAGCGACAACTTCGGCGGCACCATCGACCCCTACGCCTGCATCAGCTTCAGCCGACGT
CAGGAGCTCGCGAGGACCAAGACGATCGAGGACAACCCCAACCCCAGGTGGAACGAGACGCACTATCTCATCGTC
ACCTCCTTCAACGACACCCTCGACATTCAGGTCTTCGACAAGAACGACTTCCGAAAGTCAAAGGAGCTCGGCGTG
GCTTCCTTCCATCTGGAAGACATCGAAGACCTGCACGTGTTCGAAAATGAGCGCCTCGAGGTCATCTCCGACGGC
AAGGCCCGCGGCATCGTCTCCTGCGACCTCCGCTTCTTCCCGGTCCTGGAGGCGAAGAAGCTCCCCGACGGCAAG
ACGACGGAGCCCCCGCCGCCGTCCAACCAGGGCATCCTGCGCTTCACCATCGAGCAGGCCAAGGACTTGGACGGC
ACCAAGAGTCTCGTCGGCCTCCTCAACCCTTACGCCGTCATGTTCCTCAACGGCAAGACCGTCCACCAGACCAAG
AAGCTCAAGCGCACAAACAACCCCATCTGGGACAACGGCTCCAAGGAGATACTCATCACCGACCGCAAGAGGGCC
AAGCTCGGCGTCACCATCAAGGACGACCGGGACCTTACCGGAGACCAGACTCTGGGCAAGTATCAGATCAGGCTG
GACGAGATGCTCGACTGCATGGAGCAGGGCAAGGAGTGGTATCAGCTGTCCGGGGCCCAGTCCGGTCGCGTCAAG
ATGATGGCCCAGTGGAGACCGGTCGCCATCACCGGTGTGGCCGGCACCGGCGGTTACCTCACCCCCATCGGCGTC
ATGCGATTCCACTTCAAGAGGGCGACCGACCTGCGCAACTTCGAGGCCTTTGGAAAGTCGGATCCGTACGTCCGG
GTGCTGCTGTCCGGCATCGACAAGGCTCGAACGGTCACCTTCAGGAACGATCTGAACCCCGAGTGGGACGAGGTG
CTTTACGTACCCATCCACTCCGCGCGCGACAGGCTCACCCTGGAGGTCATGGATGCCGAGAAGATGGGCAAGGAT
CGCAGCCTCGGCCTTGTCGAGCTGTCTGCCGCCGACTACGTGCAGCAGGCCGACAACGGCGAATATCTCGTCGAC
GAAAGGAAGGTTGTCCGAGACGAGGGCCTCCGCCTCCACGGCAAGGGCATCGCCAAGGGTACCCTGACTTATACT
GCTTCATTCTACCCCTGTCTCAACATCGCAGATCCCGAGGAGGAGGAGGAGGGTGAGGAGGGCACGGAGAAGGGG
GCCGAAAAGGCGTCGGAGGACGATAAAGAGCAGGAAGCCTCGGAAGACGCCGCGAAGAGCAGCGAGCAGCCGAGG
ACGTCGGTCGAGCGATCGTCACAAGCCGGCAAGTTCAAGGCCAGCCTGGATAAGGACGGCGAGGAGCGGCCAAGG
AGCTCGCACTCGACTGCGGGGCGACCGTCGGTCGAGGACCACGGGCCCCCCAAAATCCGACTCAGCCCCGAGGAG
CTCCTCAAGTACGAGAGCGGACTGCTCATCTTCCGCCTGCTGGAGGGCGAGATGCCGGAGAGCCACTGCCGGCTG
GAGGTGTTCGTCGACGACATGGCCTACGCGTCTTACGTTTCCTCGACGTCGTCGGCAAAGACACACAAGTTCGAC
GAGATCGGTGACTGTGTCATCCGCGAACTCGACGTCTCGCGGCTGACGCTCAAGGCGCGAAAGAAGGGCGACGAC
AACGACCACACTCTCGCCCAGCTGGCGGGCAACACTATGGAGACGCTCAAGCAGTGCCTGGTGAGTCGGTGGACG
AGGAGCGGAGGCGGGGCTGTGCGATGAAGCCGTGAAGCTGACCAGAAGCCCGACAGAACAACCCGACGAAGCTCA
AGCTGAGGACCGACGACGGCCGAGACGGGTGGGTCAAGGTCAGCCTCAAGTACATCCCCATCAAGATGCAGCTGG
ATCCGAGCGAGAGCATCAACAACATGGGGAGGCTTCGGGTGGACATCCTGGACGGCGTCGACCTGCCCTCAGCGG
ACCGGAACGGGAAGAGCGACCCGTACTGCAAGTTCGAGCTCAACGGCCACGAAGTCTACAAGACAAAGGTGCAGA
AGAAGACGCTGTCGCCCGTGTGGAACGAGTTCTTCGAGGTCAGCGTGCCGTCGCGGACGGCGGCCGACTTCATCG
TCAACGTCTACGATTACGACTTTGCTGACAAACCCGACTTTCTCGGGTCCGCCGTCATCAACCTCGAGTCGCTCG
ACCCCTTTAAGCCGTCCGAGTCGCGGTACATCCTGGACGGCAAGTCGGGCAGCGTGCGCATCCGGATGCTCTTCC
GGCCGGACTACGTCACGCGGACCGTGCAGGGTTCGTCCACGTTCTCTTCCGGCCCCGGTAGGATCGTTACTGGCG
TGGCCGGAGCGCCCATCAAGGGCGGCGCCGCCGTGGCCGGGGCGGTGGGACATGGCGTCGGCCGGGGAGCCTCGT
TTCTCCGCCGCGGAATCTTCGGCAAGAAGGACGGGGATGACACCAACGGGTCGCTGCCCGAGGGCCTGGAGGGGC
CCATCGCGACCAGCAACGGCGGCGACCCGGCGGGCGGCAGCAGCCGGCGGCGGTCGGCGAACCACGGCGACGCCG
TGGCCGTGCCGACGATAGAGCAGCCCATATCGCGCAACAACTCGATGAGCCACAGTCGAAGCAAGAGCATCACGG
CGTCGTCGATGCACAGCGTCAGCCCAGGCGGCGGTGCGACGGGCACGGCGACGTTCACGGTGGTGGGTGCCACGG
GTTACCCGGCCTCGACCGACCTCTACATTGTCATCACCCAAATGTCGCCGAGGGAGAAGGTGGTGGGCAAGACGA
AGCACCACAAGTCGTCGACGGAGGAGTGGAGCTTCAACGAGACGTTCAGCGCCCGGTGCAGCTCGGATGCGCAGT
TCAAGATCGAGGCCAAGGGCGACCACTTCATCGGCAGCGACGACGACCTCGGCGAGCACGTCTACTTTGTGGACG
AGACGGGGGCAGCCGCTCCCAAGGAGCTGAGCGTCGGCGGCGGGACGGTGACCATCAAGAGCAACTTCCAGCCGA
CCGAATCGAACGCGCCGGACACGCCGCGGTCGCACAACCTGCGGCGCAGCTTCCTGGGCAAGCGGGAGGGCCGCT
CGAGCAGGGAGGCGACGCCGAACCCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail