Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2614
Gene name
LocationContig_163:21515..22922
Strand+
Gene length (bp)1407
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01363 FYVE FYVE zinc finger 7.7E-20 68 122
PF13639 zf-RING_2 Ring finger domain 3.4E-07 338 379

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ND25|ZNRF1_HUMAN E3 ubiquitin-protein ligase ZNRF1 OS=Homo sapiens GN=ZNRF1 PE=1 SV=2 268 383 2.0E-10
sp|F1MM41|ZNRF1_BOVIN E3 ubiquitin-protein ligase ZNRF1 OS=Bos taurus GN=ZNRF1 PE=3 SV=2 268 383 2.0E-10
sp|Q91V17|ZNRF1_MOUSE E3 ubiquitin-protein ligase ZNRF1 OS=Mus musculus GN=Znrf1 PE=1 SV=1 268 383 2.0E-10
sp|Q71FD5|ZNRF2_MOUSE E3 ubiquitin-protein ligase ZNRF2 OS=Mus musculus GN=Znrf2 PE=1 SV=1 268 383 5.0E-10
sp|Q6P4U6|ZNRF1_DANRE E3 ubiquitin-protein ligase znrf1 OS=Danio rerio GN=znrf1 PE=2 SV=1 268 383 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8ND25|ZNRF1_HUMAN E3 ubiquitin-protein ligase ZNRF1 OS=Homo sapiens GN=ZNRF1 PE=1 SV=2 268 383 2.0E-10
sp|F1MM41|ZNRF1_BOVIN E3 ubiquitin-protein ligase ZNRF1 OS=Bos taurus GN=ZNRF1 PE=3 SV=2 268 383 2.0E-10
sp|Q91V17|ZNRF1_MOUSE E3 ubiquitin-protein ligase ZNRF1 OS=Mus musculus GN=Znrf1 PE=1 SV=1 268 383 2.0E-10
sp|Q71FD5|ZNRF2_MOUSE E3 ubiquitin-protein ligase ZNRF2 OS=Mus musculus GN=Znrf2 PE=1 SV=1 268 383 5.0E-10
sp|Q6P4U6|ZNRF1_DANRE E3 ubiquitin-protein ligase znrf1 OS=Danio rerio GN=znrf1 PE=2 SV=1 268 383 9.0E-10
sp|Q08CN9|ZNRF2_DANRE E3 ubiquitin-protein ligase ZNRF2 OS=Danio rerio GN=znrf2 PE=2 SV=1 268 383 2.0E-09
sp|Q66KG7|ZNRF1_XENLA E3 ubiquitin-protein ligase znrf1 OS=Xenopus laevis GN=znrf1 PE=2 SV=1 269 383 2.0E-09
sp|Q8NHG8|ZNRF2_HUMAN E3 ubiquitin-protein ligase ZNRF2 OS=Homo sapiens GN=ZNRF2 PE=1 SV=1 268 383 2.0E-09
sp|Q9HGN5|YO45_SCHPO Putative E3 ubiquitin-protein ligase C36B7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36B7.05c PE=1 SV=1 236 380 4.0E-09
sp|Q5R5R4|RUFY2_PONAB RUN and FYVE domain-containing protein 2 OS=Pongo abelii GN=RUFY2 PE=2 SV=1 69 113 5.0E-09
sp|Q8WXA3|RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens GN=RUFY2 PE=1 SV=2 69 113 6.0E-09
sp|F7EP40|ZNRF1_XENTR E3 ubiquitin-protein ligase znrf1 OS=Xenopus tropicalis GN=znrf1 PE=3 SV=1 269 383 7.0E-09
sp|Q8BIJ7|RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus GN=Rufy1 PE=1 SV=1 42 113 8.0E-09
sp|Q96T51|RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens GN=RUFY1 PE=1 SV=2 42 113 1.0E-08
sp|Q8R4C2|RUFY2_MOUSE RUN and FYVE domain-containing protein 2 OS=Mus musculus GN=Rufy2 PE=1 SV=2 69 113 1.0E-08
sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 67 109 3.0E-08
sp|Q06651|PIB1_YEAST E3 ubiquitin-protein ligase PIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIB1 PE=1 SV=1 66 128 6.0E-08
sp|Q05B78|ZFY21_BOVIN Zinc finger FYVE domain-containing protein 21 OS=Bos taurus GN=ZFYVE21 PE=2 SV=1 60 120 8.0E-08
sp|Q9HCC9|LST2_HUMAN Lateral signaling target protein 2 homolog OS=Homo sapiens GN=ZFYVE28 PE=1 SV=3 67 120 9.0E-08
sp|Q06651|PIB1_YEAST E3 ubiquitin-protein ligase PIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIB1 PE=1 SV=1 262 370 1.0E-07
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 67 109 1.0E-07
sp|Q6ZPK7|LST2_MOUSE Lateral signaling target protein 2 homolog OS=Mus musculus GN=Zfyve28 PE=1 SV=2 67 120 2.0E-07
sp|P34657|YOTB_CAEEL Uncharacterized protein ZK632.12 OS=Caenorhabditis elegans GN=ZK632.12 PE=1 SV=2 69 130 2.0E-07
sp|Q8VCM3|ZFY21_MOUSE Zinc finger FYVE domain-containing protein 21 OS=Mus musculus GN=Zfyve21 PE=1 SV=2 32 120 2.0E-07
sp|Q13615|MTMR3_HUMAN Myotubularin-related protein 3 OS=Homo sapiens GN=MTMR3 PE=1 SV=3 66 120 3.0E-07
sp|Q5PQT2|MTMR3_RAT Myotubularin-related protein 3 OS=Rattus norvegicus GN=Mtmr3 PE=1 SV=1 66 120 3.0E-07
sp|Q8K296|MTMR3_MOUSE Myotubularin-related protein 3 OS=Mus musculus GN=Mtmr3 PE=1 SV=2 66 120 3.0E-07
sp|D3ZVP7|ZFY21_RAT Zinc finger FYVE domain-containing protein 21 OS=Rattus norvegicus GN=Zfyve21 PE=3 SV=1 60 120 4.0E-07
sp|Q9BQ24|ZFY21_HUMAN Zinc finger FYVE domain-containing protein 21 OS=Homo sapiens GN=ZFYVE21 PE=1 SV=1 60 120 4.0E-07
sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens GN=EEA1 PE=1 SV=2 68 113 5.0E-07
sp|Q91WB4|PKHF2_MOUSE Pleckstrin homology domain-containing family F member 2 OS=Mus musculus GN=Plekhf2 PE=1 SV=1 69 115 5.0E-07
sp|Q9H8W4|PKHF2_HUMAN Pleckstrin homology domain-containing family F member 2 OS=Homo sapiens GN=PLEKHF2 PE=1 SV=1 69 115 5.0E-07
sp|O59722|FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fab1 PE=3 SV=2 62 105 5.0E-07
sp|A8QCE4|LST2_BRUMA Lateral signaling target protein 2 homolog OS=Brugia malayi GN=Bm1_49520 PE=3 SV=1 68 114 5.0E-07
sp|Q9ASS2|FREE1_ARATH Protein FREE1 OS=Arabidopsis thaliana GN=FREE1 PE=1 SV=1 69 112 5.0E-07
sp|Q0WUR5|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A OS=Arabidopsis thaliana GN=FAB1A PE=2 SV=1 69 113 6.0E-07
sp|Q5ZLY5|PKHF2_CHICK Pleckstrin homology domain-containing family F member 2 OS=Gallus gallus GN=PLEKHF2 PE=2 SV=1 69 115 6.0E-07
sp|Q54TC3|SLOB1_DICDI Probable inactive serine/threonine-protein kinase slob1 OS=Dictyostelium discoideum GN=slob1 PE=3 SV=1 69 116 6.0E-07
sp|A8XJZ8|LST2_CAEBR Lateral signaling target protein 2 OS=Caenorhabditis briggsae GN=lst-2 PE=3 SV=1 62 114 8.0E-07
sp|Q9TZD0|LST2_CAEEL Lateral signaling target protein 2 OS=Caenorhabditis elegans GN=lst-2 PE=2 SV=2 62 114 9.0E-07
sp|Q7ZUV1|PKHF2_DANRE Pleckstrin homology domain-containing family F member 2 OS=Danio rerio GN=plekhf2 PE=2 SV=1 69 115 9.0E-07
sp|Q68FU1|PKHF1_RAT Pleckstrin homology domain-containing family F member 1 OS=Rattus norvegicus GN=Plekhf1 PE=2 SV=1 31 113 9.0E-07
sp|Q0P4S0|LST2_XENTR Lateral signaling target protein 2 homolog OS=Xenopus tropicalis GN=zfyve28 PE=2 SV=1 67 120 1.0E-06
sp|O96838|FYV1_DROME Putative 1-phosphatidylinositol 3-phosphate 5-kinase OS=Drosophila melanogaster GN=fab1 PE=1 SV=2 52 105 1.0E-06
sp|Q96S99|PKHF1_HUMAN Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens GN=PLEKHF1 PE=1 SV=3 61 113 1.0E-06
sp|Q54LD5|ADCD_DICDI Arrestin domain-containing protein D OS=Dictyostelium discoideum GN=adcD PE=3 SV=1 66 110 1.0E-06
sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus GN=Eea1 PE=1 SV=2 68 113 1.0E-06
sp|Q3TB82|PKHF1_MOUSE Pleckstrin homology domain-containing family F member 1 OS=Mus musculus GN=Plekhf1 PE=2 SV=1 31 113 1.0E-06
sp|A0JMD2|LST2_DANRE Lateral signaling target protein 2 homolog OS=Danio rerio GN=zfyve28 PE=2 SV=1 67 120 2.0E-06
sp|Q9BQS8|FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens GN=FYCO1 PE=1 SV=3 68 114 2.0E-06
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 69 226 2.0E-06
sp|Q17AN2|LST2_AEDAE Lateral signaling target protein 2 homolog OS=Aedes aegypti GN=AAEL005241 PE=3 SV=1 54 106 2.0E-06
sp|Q0U4Z8|VPS27_PHANO Vacuolar protein sorting-associated protein 27 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VPS27 PE=3 SV=1 65 120 3.0E-06
sp|Q9LUM0|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana GN=FAB1B PE=2 SV=1 69 110 4.0E-06
sp|O13821|VPS27_SCHPO Vacuolar protein sorting-associated protein 27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sst4 PE=3 SV=1 67 120 6.0E-06
sp|Q80Y56|RBNS5_MOUSE Rabenosyn-5 OS=Mus musculus GN=Rbsn PE=1 SV=1 47 105 7.0E-06
sp|B0WAQ0|LST2_CULQU Lateral signaling target protein 2 homolog OS=Culex quinquefasciatus GN=CPIJ004116 PE=3 SV=1 57 106 8.0E-06
sp|Q9H1K0|RBNS5_HUMAN Rabenosyn-5 OS=Homo sapiens GN=RBSN PE=1 SV=2 47 105 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2614
MLDLPHSRARHEEAFGPPAMDGHWQSAARRSSAGSAARRAHLSDGGVARHRTRTGGDDRGSPEFALPRWQPDAEV
TYCPICHTQFSIFVRKHHCRKCGRVVCNSCSPHRIIIPHQYIVRPPGSEISMPSSLLLDGLGAGYFEANGPSGGE
RVRLCNPHGNVYGVAQAANGYGAAAFTANRSGDAYQYYSPRWRSVTMGPATQGGSTGSAGHPARIGAAYSSPLDH
FLAAGPPSTSTSSRRHRHSSFGEAASSRQRALPPPPQIAEEDECPICHRELPSRELPDFETLRESHITMCIQAHS
AYGSPRAGGGEPGPHAAPRRTGMYTYAATEKDCIDDAECTICLEEFTVGVTMARLECLCRFHKACISAWFVSHPG
RCPVHQHDGFGF*
Coding >Hirsu2|2614
ATGCTGGACCTGCCACATTCTAGGGCGAGGCACGAGGAGGCCTTTGGACCTCCCGCCATGGACGGGCACTGGCAG
TCGGCGGCGCGAAGGAGTTCGGCCGGCTCAGCCGCTCGCAGGGCTCATCTGTCGGACGGTGGCGTCGCACGCCAT
CGGACTCGCACAGGCGGCGACGATCGCGGCTCCCCGGAATTCGCCCTCCCGAGATGGCAACCCGACGCCGAGGTG
ACGTACTGCCCTATTTGCCATACGCAGTTCAGTATCTTTGTGCGGAAGCATCACTGCAGGAAATGCGGACGAGTT
GTGTGCAACTCCTGCTCACCCCACCGAATCATCATACCTCACCAGTACATTGTACGTCCGCCAGGCTCCGAAATC
TCCATGCCATCGAGCCTACTCCTCGATGGCTTGGGGGCAGGATATTTCGAGGCCAACGGGCCGTCCGGGGGCGAG
AGAGTGCGGCTCTGCAATCCCCACGGAAACGTTTACGGAGTCGCGCAAGCGGCCAACGGATATGGGGCGGCGGCC
TTTACCGCGAACCGCAGCGGCGACGCCTATCAGTATTATTCTCCGCGATGGAGAAGTGTCACGATGGGACCTGCG
ACTCAGGGAGGCAGCACCGGCTCGGCTGGTCATCCTGCTCGTATCGGTGCGGCATACTCTTCTCCCCTCGATCAC
TTCCTCGCGGCAGGCCCACCCAGCACGTCGACGTCGTCGCGCCGACATCGACACAGCTCGTTCGGGGAGGCGGCG
TCGTCGCGGCAACGCGCGCTACCCCCTCCGCCCCAGATCGCCGAGGAGGACGAGTGCCCCATCTGCCACCGAGAA
CTACCGTCACGGGAGCTACCAGACTTTGAGACGCTGCGCGAGTCACACATAACCATGTGCATCCAGGCGCATAGC
GCCTACGGCAGCCCTCGAGCCGGCGGCGGGGAACCGGGGCCCCACGCAGCTCCGCGGCGCACCGGCATGTACACG
TACGCGGCTACGGAGAAGGACTGCATCGACGACGCCGAGTGCACGATTTGCCTGGAGGAATTCACGGTCGGCGTG
ACCATGGCACGCCTCGAGTGTCTTTGTCGCTTTCACAAGGCTTGCATCTCGGCATGGTTCGTGAGCCACCCGGGA
CGATGCCCGGTCCACCAGCATGACGGGTTTGGATTCTAG
Transcript >Hirsu2|2614
ATGCTGGACCTGCCACATTCTAGGGCGAGGCACGAGGAGGCCTTTGGACCTCCCGCCATGGACGGGCACTGGCAG
TCGGCGGCGCGAAGGAGTTCGGCCGGCTCAGCCGCTCGCAGGGCTCATCTGTCGGACGGTGGCGTCGCACGCCAT
CGGACTCGCACAGGCGGCGACGATCGCGGCTCCCCGGAATTCGCCCTCCCGAGATGGCAACCCGACGCCGAGGTG
ACGTACTGCCCTATTTGCCATACGCAGTTCAGTATCTTTGTGCGGAAGCATCACTGCAGGAAATGCGGACGAGTT
GTGTGCAACTCCTGCTCACCCCACCGAATCATCATACCTCACCAGTACATTGTACGTCCGCCAGGCTCCGAAATC
TCCATGCCATCGAGCCTACTCCTCGATGGCTTGGGGGCAGGATATTTCGAGGCCAACGGGCCGTCCGGGGGCGAG
AGAGTGCGGCTCTGCAATCCCCACGGAAACGTTTACGGAGTCGCGCAAGCGGCCAACGGATATGGGGCGGCGGCC
TTTACCGCGAACCGCAGCGGCGACGCCTATCAGTATTATTCTCCGCGATGGAGAAGTGTCACGATGGGACCTGCG
ACTCAGGGAGGCAGCACCGGCTCGGCTGGTCATCCTGCTCGTATCGGTGCGGCATACTCTTCTCCCCTCGATCAC
TTCCTCGCGGCAGGCCCACCCAGCACGTCGACGTCGTCGCGCCGACATCGACACAGCTCGTTCGGGGAGGCGGCG
TCGTCGCGGCAACGCGCGCTACCCCCTCCGCCCCAGATCGCCGAGGAGGACGAGTGCCCCATCTGCCACCGAGAA
CTACCGTCACGGGAGCTACCAGACTTTGAGACGCTGCGCGAGTCACACATAACCATGTGCATCCAGGCGCATAGC
GCCTACGGCAGCCCTCGAGCCGGCGGCGGGGAACCGGGGCCCCACGCAGCTCCGCGGCGCACCGGCATGTACACG
TACGCGGCTACGGAGAAGGACTGCATCGACGACGCCGAGTGCACGATTTGCCTGGAGGAATTCACGGTCGGCGTG
ACCATGGCACGCCTCGAGTGTCTTTGTCGCTTTCACAAGGCTTGCATCTCGGCATGGTTCGTGAGCCACCCGGGA
CGATGCCCGGTCCACCAGCATGACGGGTTTGGATTCTAG
Gene >Hirsu2|2614
ATGCTGGACCTGCCACATTCTAGGGCGAGGCACGAGGAGGCCTTTGGACCTCCCGCCATGGACGGGCACTGGCAG
TCGGCGGCGCGAAGGAGTTCGGCCGGCTCAGCCGCTCGCAGGGCTCATCTGTCGGACGGTGGCGTCGCACGCCAT
CGGACTCGCACAGGCGGCGACGATCGCGGCTCCCCGGAATTCGCCCTCCCGAGATGGCAACCCGACGCCGAGGTG
ACGTACTGCCCTATTTGCCATACGCAGTTCAGTATCTTTGTGCGGAAGCATCACTGCAGGTACGTCCCCACGGAC
GTACGCCACAGCCGATGGGGGTGCCGGCTCCAGCTGACGAGAGGACAGGAAATGCGGACGAGTTGTGTGCAACTC
CTGCTCACCCCACCGAATCATCATACCTCACCAGTACATTGTACGTCCGCCAGGCTCCGAAATCTCCATGCCATC
GAGCCTACTCCTCGATGGCTTGGGGGCAGGATATTTCGAGGCCAACGGGCCGTCCGGGGGCGAGAGAGTGCGGCT
CTGCAATCCGTGCGTCCCGGACCCGAACACGGCACCGCCCCAGAGTCCAGCCTCGTCTACGGGAACTTCCGCCCA
GTCATCTCACCATCGGTCGCGAAGCAGCCACGGAAACGTTTACGGAGTCGCGCAAGCGGCCAACGGATATGGGGC
GGCGGCCTTTACCGCGAACCGCAGCGGCGACGCCTATCAGTATTATTCTCCGCGATGGAGAAGTGTCACGATGGT
GAGCCCCCCAGCCTTTCTCTCCCCCCCTCCCCCCTTCCTCTTACCGCGGCTGCGTCTGTTGCGAGTCTGACACCT
TCACGTCAGGGACCTGCGACTCAGGGAGGCAGCACCGGCTCGGCTGGTCATCCTGCTCGTATCGGTGCGGCATAC
TCTTCTCCCCTCGATCACTTCCTCGCGGCAGGCCCACCCAGCACGTCGACGTCGTCGCGCCGACATCGACACAGC
TCGTTCGGGGAGGCGGCGTCGTCGCGGCAACGCGCGCTACCCCCTCCGCCCCAGATCGCCGAGGAGGACGAGTGC
CCCATCTGCCACCGAGAACTACCGTCACGGGAGCTACCAGACTTTGAGACGCTGCGCGAGTCACACATAACCATG
TGCATCCAGGCGCATAGCGCCTACGGCAGCCCTCGAGCCGGCGGCGGGGAACCGGGGCCCCACGCAGCTCCGCGG
CGCACCGGCATGTACACGTACGCGGCTACGGAGAAGGACTGCATCGACGACGCCGAGTGCACGATTTGCCTGGAG
GAATTCACGGTCGGCGTGACCATGGCACGCCTCGAGTGTCTTTGTCGCTTTCACAAGGCTTGCATCTCGGCATGG
TTCGTGAGCCACCCGGGACGATGCCCGGTCCACCAGCATGACGGGTTTGGATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail