Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2613
Gene name
LocationContig_163:18121..20000
Strand+
Gene length (bp)1879
Transcript length (bp)1653
Coding sequence length (bp)1653
Protein length (aa) 551

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.5E-35 64 483
PF00083 Sugar_tr Sugar (and other) transporter 1.2E-11 106 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 37 533 1.0E-48
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 30 538 9.0E-42
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 122 529 2.0E-24
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 122 529 1.0E-23
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 32 545 4.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 37 533 1.0E-48
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 30 538 9.0E-42
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 122 529 2.0E-24
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 122 529 1.0E-23
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 32 545 4.0E-23
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 120 469 1.0E-22
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 15 529 9.0E-18
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 32 529 4.0E-17
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 44 529 5.0E-17
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 11 440 8.0E-16
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 45 529 1.0E-15
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 45 482 2.0E-14
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 4 441 3.0E-14
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 45 528 6.0E-14
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 45 529 1.0E-13
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 45 528 1.0E-12
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 45 528 4.0E-12
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 44 528 2.0E-10
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 1 445 3.0E-10
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 117 431 3.0E-09
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 327 516 3.0E-09
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 104 464 5.0E-09
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 310 509 6.0E-09
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 122 478 7.0E-09
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 386 529 7.0E-09
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 11 528 8.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 45 464 1.0E-08
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 39 528 1.0E-08
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 46 464 3.0E-08
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 45 441 1.0E-07
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 45 441 1.0E-07
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 126 275 5.0E-07
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 78 297 2.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 129 254 2.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 129 264 2.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 129 264 2.0E-06
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 117 408 3.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 129 264 3.0E-06
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 129 264 3.0E-06
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 129 264 4.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 113 249 4.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 129 264 5.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 129 264 5.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 129 264 5.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 129 264 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 108 130 22
3 137 154 17
4 169 191 22
5 198 220 22
6 224 246 22
7 323 345 22
8 365 387 22
9 407 429 22
10 439 461 22
11 468 487 19
12 502 524 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2613
MSKQEVTVAALGHADDDGRRGQTLGRVRLMHRDTKALILVPAPTSDPNDPLNWPQWLKYYIAALLCLAMAMCNFL
AAGPTIAIVQTALDFFPGAAADHSLMTSAIPKVAFFFTTTSLLQGTGNLVWVPVANKWGRRPVYILSYLIYLATS
VWLIFDRSYAGSLAARVLMGFGAGAAETVAPMSIADMFFLHERGAIMSAYTCFLSVGVAAGIIISGLITIDYHWR
TIYEVGSALVGLVLLLAIFTFPETAYPRRTAVAESSWSSEKRPDPQSSSSPPSSRSDVGAATTRPEGKRQSYLAS
LRIFRGTLTEENVFKMMVRPFGLILLPPVLWAAMVQAATIGFLVAVTSNVDPAFEQAYHFKPYQVGLCFFSAVVG
SLLGLPAGGRLSDKVADILTRRNGGVREPEMRLPAIMISAITSPLALILFGVGIQHRLHWICPTIGLGLLNFSIT
QATNVCLVYVIDAYRPVAGEVTLAVMGFKSLFGFFLSFETNPWINSSGYQNAYGAMAGISAAVLIMWVPLYIWGK
RIRHGTWKWSVVSFVHWSDDREVGE*
Coding >Hirsu2|2613
ATGTCGAAGCAGGAGGTGACGGTCGCGGCGCTGGGCCATGCCGACGACGATGGGCGCCGCGGGCAGACGTTGGGG
CGCGTCCGGCTCATGCATCGCGACACCAAGGCCCTCATCTTGGTCCCGGCCCCGACCTCCGACCCCAACGACCCC
CTGAACTGGCCCCAATGGCTCAAGTACTACATCGCCGCCCTCCTCTGCCTGGCCATGGCCATGTGCAACTTCCTG
GCCGCCGGGCCGACCATCGCCATCGTCCAGACGGCCCTCGACTTCTTCCCCGGCGCCGCGGCCGACCACTCGCTC
ATGACGTCGGCCATACCCAAGGTCGCCTTCTTCTTCACCACCACCTCCCTGCTCCAGGGCACCGGCAACCTCGTC
TGGGTTCCCGTCGCCAACAAGTGGGGGCGGAGGCCGGTCTACATCCTCAGCTACCTCATCTACCTGGCCACCTCC
GTATGGCTCATCTTCGACAGGTCCTATGCCGGCTCGCTCGCGGCCCGCGTGCTGATGGGCTTCGGCGCCGGCGCC
GCCGAGACCGTCGCCCCCATGTCCATTGCCGACATGTTCTTCCTCCACGAGAGAGGCGCCATCATGTCCGCCTAC
ACCTGCTTTCTCTCGGTCGGCGTTGCCGCCGGCATCATCATCTCGGGCCTCATCACCATCGATTACCACTGGCGA
ACCATCTACGAGGTCGGCTCTGCCTTGGTCGGCCTGGTCCTGCTCTTGGCCATCTTCACCTTCCCGGAAACGGCC
TACCCGCGCCGGACGGCCGTGGCGGAGAGCTCCTGGTCGTCGGAGAAGAGGCCAGACCCTCAGTCGTCCTCCTCT
CCGCCGTCTTCGCGGTCCGACGTTGGAGCGGCGACGACGCGACCGGAAGGCAAGAGGCAGAGCTACCTCGCATCC
CTCCGCATCTTCCGCGGCACCTTGACGGAGGAGAATGTATTCAAAATGATGGTCCGCCCCTTTGGCTTGATCCTC
CTTCCGCCGGTCCTTTGGGCCGCCATGGTGCAGGCCGCCACCATTGGATTCCTGGTGGCCGTCACGTCCAACGTT
GATCCCGCCTTCGAGCAGGCCTACCATTTCAAGCCCTACCAAGTCGGACTGTGTTTCTTCTCCGCCGTTGTCGGC
TCACTGCTCGGCCTGCCCGCCGGAGGGCGGCTGAGCGACAAGGTTGCCGACATCCTGACCAGGCGAAACGGCGGC
GTCAGAGAGCCCGAGATGCGGCTGCCGGCCATCATGATCTCTGCCATCACCTCGCCTCTGGCCCTGATCCTTTTC
GGCGTCGGCATACAGCATCGGCTGCACTGGATATGCCCAACCATCGGACTGGGCCTCTTGAACTTTTCCATCACG
CAAGCCACCAACGTTTGTCTTGTCTATGTCATCGACGCGTACCGTCCTGTCGCCGGTGAAGTCACGCTGGCAGTC
ATGGGCTTCAAATCTCTGTTCGGCTTCTTCCTCTCATTCGAGACGAATCCGTGGATCAACAGCAGCGGCTATCAA
AATGCGTACGGAGCCATGGCGGGCATCTCCGCCGCTGTGCTTATCATGTGGGTGCCGCTGTATATCTGGGGCAAG
CGAATCCGACATGGCACCTGGAAGTGGTCTGTCGTGTCCTTTGTACATTGGAGTGACGATCGCGAGGTCGGAGAA
TAG
Transcript >Hirsu2|2613
ATGTCGAAGCAGGAGGTGACGGTCGCGGCGCTGGGCCATGCCGACGACGATGGGCGCCGCGGGCAGACGTTGGGG
CGCGTCCGGCTCATGCATCGCGACACCAAGGCCCTCATCTTGGTCCCGGCCCCGACCTCCGACCCCAACGACCCC
CTGAACTGGCCCCAATGGCTCAAGTACTACATCGCCGCCCTCCTCTGCCTGGCCATGGCCATGTGCAACTTCCTG
GCCGCCGGGCCGACCATCGCCATCGTCCAGACGGCCCTCGACTTCTTCCCCGGCGCCGCGGCCGACCACTCGCTC
ATGACGTCGGCCATACCCAAGGTCGCCTTCTTCTTCACCACCACCTCCCTGCTCCAGGGCACCGGCAACCTCGTC
TGGGTTCCCGTCGCCAACAAGTGGGGGCGGAGGCCGGTCTACATCCTCAGCTACCTCATCTACCTGGCCACCTCC
GTATGGCTCATCTTCGACAGGTCCTATGCCGGCTCGCTCGCGGCCCGCGTGCTGATGGGCTTCGGCGCCGGCGCC
GCCGAGACCGTCGCCCCCATGTCCATTGCCGACATGTTCTTCCTCCACGAGAGAGGCGCCATCATGTCCGCCTAC
ACCTGCTTTCTCTCGGTCGGCGTTGCCGCCGGCATCATCATCTCGGGCCTCATCACCATCGATTACCACTGGCGA
ACCATCTACGAGGTCGGCTCTGCCTTGGTCGGCCTGGTCCTGCTCTTGGCCATCTTCACCTTCCCGGAAACGGCC
TACCCGCGCCGGACGGCCGTGGCGGAGAGCTCCTGGTCGTCGGAGAAGAGGCCAGACCCTCAGTCGTCCTCCTCT
CCGCCGTCTTCGCGGTCCGACGTTGGAGCGGCGACGACGCGACCGGAAGGCAAGAGGCAGAGCTACCTCGCATCC
CTCCGCATCTTCCGCGGCACCTTGACGGAGGAGAATGTATTCAAAATGATGGTCCGCCCCTTTGGCTTGATCCTC
CTTCCGCCGGTCCTTTGGGCCGCCATGGTGCAGGCCGCCACCATTGGATTCCTGGTGGCCGTCACGTCCAACGTT
GATCCCGCCTTCGAGCAGGCCTACCATTTCAAGCCCTACCAAGTCGGACTGTGTTTCTTCTCCGCCGTTGTCGGC
TCACTGCTCGGCCTGCCCGCCGGAGGGCGGCTGAGCGACAAGGTTGCCGACATCCTGACCAGGCGAAACGGCGGC
GTCAGAGAGCCCGAGATGCGGCTGCCGGCCATCATGATCTCTGCCATCACCTCGCCTCTGGCCCTGATCCTTTTC
GGCGTCGGCATACAGCATCGGCTGCACTGGATATGCCCAACCATCGGACTGGGCCTCTTGAACTTTTCCATCACG
CAAGCCACCAACGTTTGTCTTGTCTATGTCATCGACGCGTACCGTCCTGTCGCCGGTGAAGTCACGCTGGCAGTC
ATGGGCTTCAAATCTCTGTTCGGCTTCTTCCTCTCATTCGAGACGAATCCGTGGATCAACAGCAGCGGCTATCAA
AATGCGTACGGAGCCATGGCGGGCATCTCCGCCGCTGTGCTTATCATGTGGGTGCCGCTGTATATCTGGGGCAAG
CGAATCCGACATGGCACCTGGAAGTGGTCTGTCGTGTCCTTTGTACATTGGAGTGACGATCGCGAGGTCGGAGAA
TAG
Gene >Hirsu2|2613
ATGTCGAAGCAGGAGGTGACGGTCGCGGCGCTGGGCCATGCCGACGACGATGGGCGCCGCGGGCAGACGTTGGGG
CGCGTCCGGCTCATGCATCGCGACACCAAGGCCCTCATCTTGGTCCCGGCCCCGACCTCCGACCCCAACGACCCC
CTGAACTGGTCCGTCCCTGTCCCCCCCATTTCTCTCGCCCTCGGCCCCCGAGACGCGGCTGGCCTGGGGCGGCGC
GGCGCCGGCTGACGGACTGACGATGGTGAGCGCCGCAGGCCCCAATGGCTCAAGTACTACATCGCCGCCCTCCTC
TGCCTGGCCATGGCCATGTGCAACTTCCTGGCCGCCGGGCCGACCATCGCCATCGTCCAGACGGCCCTCGACTTC
TTCCCCGGCGCCGCGGCCGACCACTCGCTCATGACGTCGGCCATACCCAAGGTCGCCTTCTTCTTCACCACCACC
TCCCTGCTCCAGGGCACCGGCAACCTCGTCTGGGTTCCCGTCGCCAACAAGTGGGGGCGGAGGCCGGTCTACATC
CTCAGCTACCTCATCTACCTGGCCACCTCCGTATGGCTCATCTTCGACAGGTCCTATGCCGGCTCGCTCGCGGCC
CGCGTGCTGATGGGCTTCGGCGCCGGCGCCGCCGAGACCGTCGCCCCCATGTCCATTGCCGACATGTTCTTCCTC
CACGAGAGAGGCGCCATCATGTCCGCCTACACCTGCTTTCTCTCGGTCGGCGTTGCCGCCGGCATCATCATCTCG
GGCCTCATCACCATCGATTACCACTGGCGAACCATCTACGAGGTCGGCTCTGCCTTGGTCGGCCTGGTCCTGCTC
TTGGCCATCTTCACCTTCCCGGAAACGGCCTACCCGCGCCGGACGGCCGTGGCGGAGAGCTCCTGGTCGTCGGAG
AAGAGGCCAGACCCTCAGTCGTCCTCCTCTCCGCCGTCTTCGCGGTCCGACGTTGGAGCGGCGACGACGCGACCG
GAAGGCAAGAGGCAGAGCTACCTCGCATCCCTCCGCATCTTCCGCGGCACCTTGACGGAGGAGAATGTATTCAAA
ATGATGGTCCGCCCCTTTGGCTTGATCCTCCTTCCGCCGGTCCTTTGGGCCGCCATGGTGCAGGCCGCCACCATT
GGATTCCTGGTGGCCGTCACGTCCAACGTTGATCCCGCCTTCGAGCAGGCCTACCATTTCAAGCCCTACCAAGTC
GGACTGTGTTTCTTCTCCGCCGTTGTCGGCTCACTGCTCGGCCTGCCCGCCGGAGGGCGGCTGAGCGACAAGGTT
GCCGACATCCTGACCAGGCGAAACGGCGGCGTCAGAGAGCCCGAGATGCGGCTGCCGGCCATCATGATCTCTGCC
ATCACCTCGCCTCTGGCCCTGATCCTTTTCGGCGTCGGCATACAGCATCGGCTGCACTGGATATGCCCAACCATC
GGACTGGGCCTCTGTAGGTGTCTCCCGCGGTCTCGTACCCCGACATGCAGACTAACTGGGAGACTGCAGTGAACT
TTTCCATCACGCAAGCCACCAACGTTTGTCTTGTCTATGTCATCGACGCGTACCGTCCTGTCGCCGGTGAAGTCA
CGCTGGCAGTCATGGGCTTCAAATGTGGGTGGTCACCCTTCCCGTTGTCGGCTCTCGGCGAGGGCACGACGAGGC
TGACGTGGCACCAGCTCTGTTCGGCTTCTTCCTCTCATTCGAGACGAATCCGTGGATCAACAGCAGCGGCTATCA
AAATGCGTACGGAGCCATGGCGGGCATCTCCGCCGCTGTGCTTATCATGTGGGTGCCGCTGTATATCTGGGGCAA
GCGAATCCGACATGGCACCTGGAAGTGGTCTGTCGTGTCCTTTGTACATTGGAGTGACGATCGCGAGGTCGGAGA
ATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail