Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2610
Gene name
LocationContig_163:10582..12124
Strand-
Gene length (bp)1542
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.2E-66 165 409
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.5E-30 168 407

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 114 497 3.0E-130
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 155 512 6.0E-94
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 144 496 5.0E-91
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 144 496 6.0E-91
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 158 506 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 114 497 3.0E-130
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 155 512 6.0E-94
sp|Q9Z1M4|KS6B2_MOUSE Ribosomal protein S6 kinase beta-2 OS=Mus musculus GN=Rps6kb2 PE=1 SV=1 144 496 5.0E-91
sp|Q9UBS0|KS6B2_HUMAN Ribosomal protein S6 kinase beta-2 OS=Homo sapiens GN=RPS6KB2 PE=1 SV=2 144 496 6.0E-91
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 158 506 1.0E-90
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 158 496 1.0E-90
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 158 496 6.0E-90
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 158 496 6.0E-90
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 158 496 7.0E-90
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 158 496 7.0E-90
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 158 501 3.0E-89
sp|P54644|KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum GN=pkbA PE=1 SV=1 149 497 3.0E-89
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 112 501 5.0E-89
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 163 494 6.0E-89
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 163 494 7.0E-89
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 158 501 9.0E-89
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 158 498 4.0E-88
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 158 503 4.0E-88
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 162 501 6.0E-88
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 158 501 8.0E-88
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 158 498 9.0E-88
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 170 499 1.0E-87
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 162 491 3.0E-87
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 158 501 4.0E-87
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 158 501 1.0E-86
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 164 493 1.0E-86
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 164 501 2.0E-86
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 147 495 2.0E-85
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 147 466 2.0E-84
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 147 466 2.0E-84
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 147 466 2.0E-84
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 147 466 3.0E-84
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 163 498 4.0E-84
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 155 466 5.0E-84
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 158 501 5.0E-84
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 85 464 7.0E-84
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 158 501 9.0E-84
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 156 496 2.0E-82
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 156 506 3.0E-82
sp|Q2PJ68|SGK1_CAEEL Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis elegans GN=sgk-1 PE=1 SV=1 140 497 4.0E-82
sp|A8XNJ6|SGK1_CAEBR Serine/threonine-protein kinase sgk-1 OS=Caenorhabditis briggsae GN=sgk-1 PE=3 SV=3 145 497 1.0E-81
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 116 507 2.0E-81
sp|Q9QZS5|SGK2_MOUSE Serine/threonine-protein kinase Sgk2 OS=Mus musculus GN=Sgk2 PE=1 SV=1 141 490 4.0E-81
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 143 465 4.0E-81
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 143 465 7.0E-81
sp|Q9HBY8|SGK2_HUMAN Serine/threonine-protein kinase Sgk2 OS=Homo sapiens GN=SGK2 PE=1 SV=1 141 490 9.0E-81
sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase Sgk2 OS=Rattus norvegicus GN=Sgk2 PE=1 SV=2 141 490 9.0E-81
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 143 493 1.0E-80
sp|Q7ZTW4|SGK1_DANRE Serine/threonine-protein kinase Sgk1 OS=Danio rerio GN=sgk1 PE=2 SV=1 154 490 2.0E-80
sp|Q5Q0U5|SGK1_FUNHE Serine/threonine-protein kinase Sgk1 OS=Fundulus heteroclitus GN=sgk1 PE=2 SV=1 154 493 4.0E-80
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 147 493 1.0E-79
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 158 465 3.0E-79
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 158 493 4.0E-79
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 147 493 7.0E-79
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 147 493 1.0E-78
sp|Q5BKK4|SGK1_XENTR Serine/threonine-protein kinase Sgk1 OS=Xenopus tropicalis GN=sgk1 PE=2 SV=1 154 490 1.0E-77
sp|Q6GPN6|SGK1A_XENLA Serine/threonine-protein kinase Sgk1-A OS=Xenopus laevis GN=sgk1-a PE=2 SV=1 154 490 2.0E-77
sp|Q9P7J8|GAD8_SCHPO Serine/threonine-protein kinase gad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gad8 PE=1 SV=1 154 460 7.0E-77
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 158 465 3.0E-76
sp|Q6GLY8|SGK1B_XENLA Serine/threonine-protein kinase Sgk1-B OS=Xenopus laevis GN=sgk1-b PE=2 SV=1 154 490 1.0E-75
sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase Sgk1 OS=Homo sapiens GN=SGK1 PE=1 SV=2 154 490 1.0E-74
sp|Q6U1I9|SGK1_CHICK Serine/threonine-protein kinase Sgk1 OS=Gallus gallus GN=SGK1 PE=2 SV=1 154 490 1.0E-74
sp|Q4R633|SGK1_MACFA Serine/threonine-protein kinase Sgk1 OS=Macaca fascicularis GN=SGK1 PE=2 SV=1 154 490 2.0E-74
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 157 451 2.0E-74
sp|P12688|YPK1_YEAST Serine/threonine-protein kinase YPK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK1 PE=1 SV=2 157 496 2.0E-74
sp|Q9WVC6|SGK1_MOUSE Serine/threonine-protein kinase Sgk1 OS=Mus musculus GN=Sgk1 PE=1 SV=1 154 490 4.0E-74
sp|A7MB74|SGK1_BOVIN Serine/threonine-protein kinase Sgk1 OS=Bos taurus GN=SGK1 PE=2 SV=1 154 490 5.0E-74
sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase Sgk1 OS=Oryctolagus cuniculus GN=SGK1 PE=2 SV=1 154 490 5.0E-74
sp|Q5R7A7|SGK3_PONAB Serine/threonine-protein kinase Sgk3 OS=Pongo abelii GN=SGK3 PE=2 SV=1 154 497 7.0E-74
sp|Q96BR1|SGK3_HUMAN Serine/threonine-protein kinase Sgk3 OS=Homo sapiens GN=SGK3 PE=1 SV=1 154 497 7.0E-74
sp|P18961|YPK2_YEAST Serine/threonine-protein kinase YPK2/YKR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK2 PE=1 SV=1 141 499 8.0E-74
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 129 490 2.0E-73
sp|Q17941|AKT1_CAEEL Serine/threonine-protein kinase akt-1 OS=Caenorhabditis elegans GN=akt-1 PE=1 SV=2 158 490 3.0E-73
sp|Q06226|SGK1_RAT Serine/threonine-protein kinase Sgk1 OS=Rattus norvegicus GN=Sgk1 PE=1 SV=1 154 490 3.0E-73
sp|Q9ERE3|SGK3_MOUSE Serine/threonine-protein kinase Sgk3 OS=Mus musculus GN=Sgk3 PE=1 SV=1 154 494 5.0E-73
sp|P24723|KPCL_HUMAN Protein kinase C eta type OS=Homo sapiens GN=PRKCH PE=1 SV=4 140 492 6.0E-73
sp|P50530|SCK1_SCHPO Serine/threonine-protein kinase sck1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck1 PE=1 SV=2 162 494 7.0E-73
sp|Q8R4V0|SGK3_RAT Serine/threonine-protein kinase Sgk3 OS=Rattus norvegicus GN=Sgk3 PE=1 SV=2 154 497 8.0E-73
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 163 496 1.0E-72
sp|P06244|KAPA_YEAST cAMP-dependent protein kinase type 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK1 PE=1 SV=3 158 446 1.0E-72
sp|P23298|KPCL_MOUSE Protein kinase C eta type OS=Mus musculus GN=Prkch PE=1 SV=2 152 492 2.0E-71
sp|Q64617|KPCL_RAT Protein kinase C eta type OS=Rattus norvegicus GN=Prkch PE=1 SV=1 152 492 2.0E-71
sp|P13678|KPC3_DROME Protein kinase C OS=Drosophila melanogaster GN=Pkc98E PE=2 SV=1 137 491 2.0E-70
sp|Q54IF2|Y0670_DICDI Probable serine/threonine-protein kinase DDB_G0288795 OS=Dictyostelium discoideum GN=DDB_G0288795 PE=2 SV=1 154 497 2.0E-70
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 162 455 3.0E-70
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 158 446 6.0E-70
sp|P11792|SCH9_YEAST Serine/threonine-protein kinase SCH9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCH9 PE=1 SV=3 156 498 2.0E-69
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 162 455 2.0E-69
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 162 455 2.0E-69
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 162 455 7.0E-69
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 162 455 8.0E-69
sp|P34885|KPC1B_CAEEL Protein kinase C-like 1B OS=Caenorhabditis elegans GN=pkc-1 PE=2 SV=2 155 491 8.0E-69
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 150 447 1.0E-68
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 162 455 1.0E-68
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 162 455 1.0E-68
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 162 444 1.0E-68
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 162 444 1.0E-68
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 162 455 2.0E-68
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 162 455 5.0E-68
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 162 444 1.0E-67
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 154 455 3.0E-67
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 162 444 5.0E-67
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 162 444 5.0E-67
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 162 444 5.0E-67
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 152 455 7.0E-67
sp|Q9XTG7|AKT2_CAEEL Serine/threonine-protein kinase akt-2 OS=Caenorhabditis elegans GN=akt-2 PE=1 SV=1 100 466 7.0E-67
sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase C OS=Aplysia californica GN=PRKC1 PE=1 SV=2 161 460 2.0E-66
sp|P36582|PCK1_SCHPO Protein kinase C-like 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck1 PE=3 SV=2 156 493 2.0E-66
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 162 469 4.0E-66
sp|Q00078|KPC1_ASPNG Protein kinase C-like OS=Aspergillus niger GN=pkcA PE=3 SV=1 156 492 5.0E-66
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 149 500 8.0E-66
sp|Q25378|KPC1_LYTPI Protein kinase C OS=Lytechinus pictus GN=PKC1 PE=2 SV=1 161 491 9.0E-66
sp|Q16975|KPC2_APLCA Calcium-independent protein kinase C OS=Aplysia californica GN=PRKC2 PE=1 SV=1 32 490 1.0E-65
sp|Q02111|KPCT_MOUSE Protein kinase C theta type OS=Mus musculus GN=Prkcq PE=1 SV=1 158 491 1.0E-65
sp|Q05513|KPCZ_HUMAN Protein kinase C zeta type OS=Homo sapiens GN=PRKCZ PE=1 SV=4 152 491 1.0E-65
sp|Q02956|KPCZ_MOUSE Protein kinase C zeta type OS=Mus musculus GN=Prkcz PE=1 SV=2 152 466 2.0E-65
sp|P90980|KPC2_CAEEL Protein kinase C-like 2 OS=Caenorhabditis elegans GN=pkc-2 PE=2 SV=2 159 491 2.0E-65
sp|P13677|KPC2_DROME Protein kinase C, eye isozyme OS=Drosophila melanogaster GN=inaC PE=1 SV=1 156 461 2.0E-65
sp|P09217|KPCZ_RAT Protein kinase C zeta type OS=Rattus norvegicus GN=Prkcz PE=1 SV=2 152 466 2.0E-65
sp|P16054|KPCE_MOUSE Protein kinase C epsilon type OS=Mus musculus GN=Prkce PE=1 SV=1 157 460 2.0E-65
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 154 455 3.0E-65
sp|Q9WTQ0|KPCT_RAT Protein kinase C theta type OS=Rattus norvegicus GN=Prkcq PE=1 SV=2 158 491 3.0E-65
sp|P10830|KPCE_RABIT Protein kinase C epsilon type OS=Oryctolagus cuniculus GN=PRKCE PE=2 SV=1 157 460 4.0E-65
sp|O42632|KPC1_COCHE Protein kinase C-like OS=Cochliobolus heterostrophus GN=PKC1 PE=3 SV=1 157 492 4.0E-65
sp|P09216|KPCE_RAT Protein kinase C epsilon type OS=Rattus norvegicus GN=Prkce PE=1 SV=1 157 460 4.0E-65
sp|Q02156|KPCE_HUMAN Protein kinase C epsilon type OS=Homo sapiens GN=PRKCE PE=1 SV=1 157 460 5.0E-65
sp|Q04759|KPCT_HUMAN Protein kinase C theta type OS=Homo sapiens GN=PRKCQ PE=1 SV=3 150 491 5.0E-65
sp|P34722|KPC1_CAEEL Protein kinase C-like 1 OS=Caenorhabditis elegans GN=tpa-1 PE=1 SV=2 151 467 5.0E-65
sp|O19111|KPCZ_RABIT Protein kinase C zeta type OS=Oryctolagus cuniculus GN=PRKCZ PE=2 SV=1 152 466 6.0E-65
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 157 470 8.0E-65
sp|P21137|KAPC1_CAEEL cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis elegans GN=kin-1 PE=1 SV=3 154 441 9.0E-65
sp|P05130|KPC1_DROME Protein kinase C, brain isozyme OS=Drosophila melanogaster GN=Pkc53E PE=2 SV=2 156 460 2.0E-64
sp|A1Z9X0|APKC_DROME Atypical protein kinase C OS=Drosophila melanogaster GN=aPKC PE=1 SV=1 156 460 3.0E-64
sp|Q5AHG6|SCH9_CANAL Serine/threonine-protein kinase SCH9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCH9 PE=3 SV=1 122 496 3.0E-64
sp|F1M7Y5|KPCI_RAT Protein kinase C iota type OS=Rattus norvegicus GN=Prkci PE=1 SV=1 162 466 4.0E-64
sp|Q5R4K9|KPCI_PONAB Protein kinase C iota type OS=Pongo abelii GN=PRKCI PE=2 SV=2 162 466 4.0E-64
sp|P41743|KPCI_HUMAN Protein kinase C iota type OS=Homo sapiens GN=PRKCI PE=1 SV=2 162 466 4.0E-64
sp|Q62074|KPCI_MOUSE Protein kinase C iota type OS=Mus musculus GN=Prkci PE=1 SV=3 162 466 4.0E-64
sp|A8XW88|KAPC1_CAEBR cAMP-dependent protein kinase catalytic subunit OS=Caenorhabditis briggsae GN=kin-1 PE=1 SV=1 162 441 4.0E-64
sp|P04409|KPCA_BOVIN Protein kinase C alpha type OS=Bos taurus GN=PRKCA PE=1 SV=3 163 491 8.0E-64
sp|P83099|KPC4_DROME Putative protein kinase C delta type homolog OS=Drosophila melanogaster GN=Pkcdelta PE=2 SV=3 74 466 9.0E-64
sp|P05696|KPCA_RAT Protein kinase C alpha type OS=Rattus norvegicus GN=Prkca PE=1 SV=3 163 491 1.0E-63
sp|P17252|KPCA_HUMAN Protein kinase C alpha type OS=Homo sapiens GN=PRKCA PE=1 SV=4 163 491 1.0E-63
sp|P10102|KPCA_RABIT Protein kinase C alpha type OS=Oryctolagus cuniculus GN=PRKCA PE=2 SV=3 163 491 2.0E-63
sp|P05771|KPCB_HUMAN Protein kinase C beta type OS=Homo sapiens GN=PRKCB PE=1 SV=4 158 467 2.0E-63
sp|P68403|KPCB_RAT Protein kinase C beta type OS=Rattus norvegicus GN=Prkcb PE=1 SV=3 158 467 2.0E-63
sp|P68404|KPCB_MOUSE Protein kinase C beta type OS=Mus musculus GN=Prkcb PE=1 SV=4 158 467 2.0E-63
sp|P05772|KPCB_RABIT Protein kinase C beta type OS=Oryctolagus cuniculus GN=PRKCB PE=2 SV=3 158 467 2.0E-63
sp|P05126|KPCB_BOVIN Protein kinase C beta type OS=Bos taurus GN=PRKCB PE=2 SV=4 158 467 2.0E-63
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 158 446 3.0E-63
sp|Q7SY24|KPCB_DANRE Protein kinase C beta type OS=Danio rerio GN=prkcbb PE=2 SV=1 156 491 4.0E-63
sp|P20444|KPCA_MOUSE Protein kinase C alpha type OS=Mus musculus GN=Prkca PE=1 SV=3 163 491 5.0E-63
sp|Q10364|SCK2_SCHPO Serine/threonine-protein kinase sck2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sck2 PE=3 SV=1 162 506 6.0E-63
sp|P87253|KPC1_NEUCR Protein kinase C-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06544 PE=3 SV=2 162 492 2.0E-62
sp|Q99014|KPC1_HYPJE Protein kinase C-like OS=Hypocrea jecorina GN=pkc1 PE=3 SV=1 162 492 1.0E-61
sp|Q7JP68|KAPC2_CAEEL cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis elegans GN=F47F2.1 PE=1 SV=1 153 455 1.0E-61
sp|P40376|KAPB_SCHPO cAMP-dependent protein kinase catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pka1 PE=1 SV=1 156 462 1.0E-61
sp|P36583|PCK2_SCHPO Protein kinase C-like 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pck2 PE=1 SV=2 157 490 1.0E-61
sp|A8KBH6|KPCB_XENTR Protein kinase C beta type OS=Xenopus tropicalis GN=prkcb PE=2 SV=1 158 493 2.0E-61
sp|Q90XF2|KPCI_DANRE Protein kinase C iota type OS=Danio rerio GN=prkci PE=2 SV=2 163 491 2.0E-61
sp|P28867|KPCD_MOUSE Protein kinase C delta type OS=Mus musculus GN=Prkcd PE=1 SV=3 68 491 9.0E-61
sp|A8XJQ6|KAPC2_CAEBR cAMP-dependent protein kinase, catalytic subunit-like OS=Caenorhabditis briggsae GN=CBG14305 PE=1 SV=2 153 455 1.0E-60
sp|A7MBL8|PKN2_DANRE Serine/threonine-protein kinase N2 OS=Danio rerio GN=pkn2 PE=2 SV=1 163 492 1.0E-60
sp|Q5PU49|KPCD_CANLF Protein kinase C delta type OS=Canis lupus familiaris GN=PRKCD PE=2 SV=1 168 491 6.0E-60
sp|P09215|KPCD_RAT Protein kinase C delta type OS=Rattus norvegicus GN=Prkcd PE=1 SV=1 162 491 7.0E-60
sp|P05129|KPCG_HUMAN Protein kinase C gamma type OS=Homo sapiens GN=PRKCG PE=1 SV=3 152 491 1.0E-59
sp|P63319|KPCG_RAT Protein kinase C gamma type OS=Rattus norvegicus GN=Prkcg PE=1 SV=1 152 491 1.0E-59
sp|P63318|KPCG_MOUSE Protein kinase C gamma type OS=Mus musculus GN=Prkcg PE=1 SV=1 152 491 1.0E-59
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 153 433 1.0E-59
sp|Q63433|PKN1_RAT Serine/threonine-protein kinase N1 OS=Rattus norvegicus GN=Pkn1 PE=1 SV=2 110 492 2.0E-59
sp|P10829|KPCG_RABIT Protein kinase C gamma type OS=Oryctolagus cuniculus GN=PRKCG PE=1 SV=1 152 491 3.0E-59
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 156 433 5.0E-59
sp|Q05655|KPCD_HUMAN Protein kinase C delta type OS=Homo sapiens GN=PRKCD PE=1 SV=2 168 491 5.0E-59
sp|P70268|PKN1_MOUSE Serine/threonine-protein kinase N1 OS=Mus musculus GN=Pkn1 PE=1 SV=3 115 492 6.0E-59
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 153 433 6.0E-59
sp|P05128|KPCG_BOVIN Protein kinase C gamma type (Fragment) OS=Bos taurus GN=PRKCG PE=2 SV=1 152 460 6.0E-59
sp|Q7LZQ8|KPCB_XENLA Protein kinase C beta type OS=Xenopus laevis GN=prkcb PE=2 SV=1 148 493 7.0E-59
sp|P25341|KIN82_YEAST Serine/threonine-protein kinase KIN82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN82 PE=1 SV=3 162 448 3.0E-58
sp|Q16513|PKN2_HUMAN Serine/threonine-protein kinase N2 OS=Homo sapiens GN=PKN2 PE=1 SV=1 162 492 4.0E-58
sp|Q4R4U2|KPCG_MACFA Protein kinase C gamma type OS=Macaca fascicularis GN=PRKCG PE=2 SV=1 152 491 7.0E-58
sp|P53739|FPK1_YEAST Flippase kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FPK1 PE=1 SV=1 162 448 8.0E-58
sp|Q8BWW9|PKN2_MOUSE Serine/threonine-protein kinase N2 OS=Mus musculus GN=Pkn2 PE=1 SV=3 151 492 9.0E-58
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKC1 PE=1 SV=3 156 491 2.0E-57
sp|A1A4I4|PKN1_BOVIN Serine/threonine-protein kinase N1 OS=Bos taurus GN=PKN1 PE=2 SV=1 154 494 2.0E-57
sp|Q16512|PKN1_HUMAN Serine/threonine-protein kinase N1 OS=Homo sapiens GN=PKN1 PE=1 SV=2 154 492 3.0E-57
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 156 482 8.0E-57
sp|A1Z7T0|PKN_DROME Serine/threonine-protein kinase N OS=Drosophila melanogaster GN=Pkn PE=1 SV=1 134 460 8.0E-57
sp|Q9USX7|PPK22_SCHPO Serine/threonine-protein kinase ppk22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk22 PE=1 SV=1 158 448 1.0E-56
sp|O08874|PKN2_RAT Serine/threonine-protein kinase N2 OS=Rattus norvegicus GN=Pkn2 PE=1 SV=2 151 492 1.0E-56
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 41 436 1.0E-56
sp|Q2LZZ7|TRC_DROPS Serine/threonine-protein kinase tricorner OS=Drosophila pseudoobscura pseudoobscura GN=trc PE=3 SV=1 126 490 1.0E-56
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 41 436 2.0E-56
sp|O42626|NRC2_NEUCR Serine/threonine-protein kinase nrc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nrc-2 PE=3 SV=1 162 444 4.0E-56
sp|Q9NBK5|TRC_DROME Serine/threonine-protein kinase tricorner OS=Drosophila melanogaster GN=trc PE=1 SV=1 126 490 9.0E-56
sp|Q09831|PPK14_SCHPO Serine/threonine-protein kinase ppk14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk14 PE=1 SV=1 164 491 1.0E-55
sp|A8WUG4|KPC3_CAEBR Protein kinase C-like 3 OS=Caenorhabditis briggsae GN=pkc-3 PE=3 SV=1 156 491 3.0E-55
sp|Q9ST27|PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica GN=PHOT2 PE=1 SV=1 79 443 3.0E-55
sp|P34100|PKD1_DICDI Developmentally-regulated protein kinase 1 OS=Dictyostelium discoideum GN=pkaD PE=2 SV=2 149 436 5.0E-55
sp|Q19266|KPC3_CAEEL Protein kinase C-like 3 OS=Caenorhabditis elegans GN=pkc-3 PE=1 SV=1 148 461 2.0E-54
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 162 433 4.0E-54
sp|P43057|KPC1_CANAX Protein kinase C-like 1 OS=Candida albicans GN=PKC1 PE=3 SV=1 156 497 6.0E-54
sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=1 SV=1 162 449 7.0E-54
sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 162 449 1.0E-53
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 162 436 2.0E-53
sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=1 SV=1 162 449 2.0E-53
sp|O13310|ORB6_SCHPO Serine/threonine-protein kinase orb6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=orb6 PE=1 SV=1 139 444 7.0E-53
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 164 408 1.0E-52
sp|Q8K045|PKN3_MOUSE Serine/threonine-protein kinase N3 OS=Mus musculus GN=Pkn3 PE=1 SV=1 162 499 2.0E-52
sp|P43249|GRK5_BOVIN G protein-coupled receptor kinase 5 OS=Bos taurus GN=GRK5 PE=1 SV=1 156 512 2.0E-52
sp|P34947|GRK5_HUMAN G protein-coupled receptor kinase 5 OS=Homo sapiens GN=GRK5 PE=1 SV=1 156 512 2.0E-52
sp|P93025|PHOT2_ARATH Phototropin-2 OS=Arabidopsis thaliana GN=PHOT2 PE=1 SV=2 164 449 2.0E-52
sp|Q54IH8|NDRB_DICDI Probable serine/threonine-protein kinase ndrB OS=Dictyostelium discoideum GN=ndrB PE=3 SV=1 158 490 8.0E-52
sp|Q8VEB1|GRK5_MOUSE G protein-coupled receptor kinase 5 OS=Mus musculus GN=Grk5 PE=1 SV=2 156 512 9.0E-52
sp|Q8SRK8|KAPC_ENCCU Probable cAMP-dependent protein kinase catalytic subunit OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0520 PE=3 SV=1 162 444 9.0E-52
sp|Q62833|GRK5_RAT G protein-coupled receptor kinase 5 OS=Rattus norvegicus GN=Grk5 PE=2 SV=1 156 512 1.0E-51
sp|Q6TGC6|CBK1_PNECA Serine/threonine-protein kinase CBK1 OS=Pneumocystis carinii GN=CBK1 PE=2 SV=1 125 453 2.0E-51
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 162 393 4.0E-51
sp|Q2QYY8|PHT1A_ORYSJ Phototropin-1A OS=Oryza sativa subsp. japonica GN=PHOT1A PE=1 SV=2 127 442 7.0E-51
sp|A8XJL7|SAX1_CAEBR Serine/threonine-protein kinase sax-1 OS=Caenorhabditis briggsae GN=sax-1 PE=3 SV=2 129 470 7.0E-51
sp|O60307|MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens GN=MAST3 PE=1 SV=2 156 430 2.0E-50
sp|Q2RBR1|PHT1B_ORYSJ Phototropin-1B OS=Oryza sativa subsp. japonica GN=PHOT1B PE=1 SV=2 127 442 3.0E-50
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 163 445 3.0E-50
sp|Q3U214|MAST3_MOUSE Microtubule-associated serine/threonine-protein kinase 3 OS=Mus musculus GN=Mast3 PE=1 SV=3 156 430 3.0E-50
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 155 441 3.0E-50
sp|A2VDV2|STK38_BOVIN Serine/threonine-protein kinase 38 OS=Bos taurus GN=STK38 PE=2 SV=1 126 490 4.0E-50
sp|Q5AP53|CBK1_CANAL Serine/threonine-protein kinase CBK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CBK1 PE=1 SV=1 156 502 6.0E-50
sp|Q9Y2H1|ST38L_HUMAN Serine/threonine-protein kinase 38-like OS=Homo sapiens GN=STK38L PE=1 SV=3 126 490 8.0E-50
sp|Q5R8M1|STK38_PONAB Serine/threonine-protein kinase 38 OS=Pongo abelii GN=STK38 PE=2 SV=1 126 490 8.0E-50
sp|Q15208|STK38_HUMAN Serine/threonine-protein kinase 38 OS=Homo sapiens GN=STK38 PE=1 SV=1 126 490 8.0E-50
sp|O15021|MAST4_HUMAN Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens GN=MAST4 PE=1 SV=3 156 433 2.0E-49
sp|Q7TSJ6|LATS2_MOUSE Serine/threonine-protein kinase LATS2 OS=Mus musculus GN=Lats2 PE=1 SV=1 156 490 2.0E-49
sp|Q60592|MAST2_MOUSE Microtubule-associated serine/threonine-protein kinase 2 OS=Mus musculus GN=Mast2 PE=1 SV=1 151 430 3.0E-49
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 155 441 3.0E-49
sp|Q7TSE6|ST38L_MOUSE Serine/threonine-protein kinase 38-like OS=Mus musculus GN=Stk38l PE=1 SV=2 126 490 3.0E-49
sp|Q6AX33|MAST3_XENLA Microtubule-associated serine/threonine-protein kinase 3 OS=Xenopus laevis GN=mast3 PE=2 SV=1 154 433 4.0E-49
sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 163 455 6.0E-49
sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 163 455 6.0E-49
sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 163 455 7.0E-49
sp|Q6P0Q8|MAST2_HUMAN Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens GN=MAST2 PE=1 SV=2 151 430 7.0E-49
sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 163 455 7.0E-49
sp|Q811L6|MAST4_MOUSE Microtubule-associated serine/threonine-protein kinase 4 OS=Mus musculus GN=Mast4 PE=1 SV=3 156 433 7.0E-49
sp|O48963|PHOT1_ARATH Phototropin-1 OS=Arabidopsis thaliana GN=PHOT1 PE=1 SV=1 164 453 8.0E-49
sp|Q54Y26|NDRA_DICDI Probable serine/threonine-protein kinase ndrA OS=Dictyostelium discoideum GN=ndrA PE=3 SV=1 158 455 1.0E-48
sp|Q91VJ4|STK38_MOUSE Serine/threonine-protein kinase 38 OS=Mus musculus GN=Stk38 PE=1 SV=1 126 490 2.0E-48
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 152 446 4.0E-48
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 156 503 5.0E-48
sp|Q9NRM7|LATS2_HUMAN Serine/threonine-protein kinase LATS2 OS=Homo sapiens GN=LATS2 PE=1 SV=2 156 490 9.0E-48
sp|Q2L6W9|SAX1_CAEEL Serine/threonine-protein kinase sax-1 OS=Caenorhabditis elegans GN=sax-1 PE=2 SV=1 158 455 1.0E-47
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 158 407 1.0E-47
sp|Q6P5Z2|PKN3_HUMAN Serine/threonine-protein kinase N3 OS=Homo sapiens GN=PKN3 PE=1 SV=1 154 460 1.0E-47
sp|O94487|PPK35_SCHPO Serine/threonine-protein kinase ppk35 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk35 PE=1 SV=1 153 490 1.0E-47
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 155 444 3.0E-47
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 155 442 4.0E-47
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 154 408 4.0E-47
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 155 442 6.0E-47
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 148 441 7.0E-47
sp|P32023|KGP25_DROME cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 OS=Drosophila melanogaster GN=for PE=2 SV=3 150 455 9.0E-47
sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 150 455 1.0E-46
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 156 408 3.0E-46
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 155 442 3.0E-46
sp|Q810W7|MAST1_RAT Microtubule-associated serine/threonine-protein kinase 1 OS=Rattus norvegicus GN=Mast1 PE=1 SV=1 156 430 3.0E-46
sp|Q9R1L5|MAST1_MOUSE Microtubule-associated serine/threonine-protein kinase 1 OS=Mus musculus GN=Mast1 PE=1 SV=3 156 430 4.0E-46
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 148 441 4.0E-46
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 156 408 4.0E-46
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 152 408 6.0E-46
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 158 407 8.0E-46
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 156 408 8.0E-46
sp|Q9Y2H9|MAST1_HUMAN Microtubule-associated serine/threonine-protein kinase 1 OS=Homo sapiens GN=MAST1 PE=1 SV=2 156 430 1.0E-45
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 157 444 1.0E-45
sp|Q9VA38|WARTS_DROME Serine/threonine-protein kinase Warts OS=Drosophila melanogaster GN=wts PE=1 SV=1 158 457 2.0E-45
sp|O70293|GRK6_MOUSE G protein-coupled receptor kinase 6 OS=Mus musculus GN=Grk6 PE=1 SV=1 156 450 2.0E-45
sp|P32865|GPRK1_DROME G protein-coupled receptor kinase 1 OS=Drosophila melanogaster GN=Gprk1 PE=2 SV=2 158 444 2.0E-45
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 157 412 3.0E-45
sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 155 449 3.0E-45
sp|Q8BYR2|LATS1_MOUSE Serine/threonine-protein kinase LATS1 OS=Mus musculus GN=Lats1 PE=1 SV=3 158 490 3.0E-45
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 84 481 3.0E-45
sp|P43250|GRK6_HUMAN G protein-coupled receptor kinase 6 OS=Homo sapiens GN=GRK6 PE=1 SV=2 156 450 4.0E-45
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 159 442 4.0E-45
sp|O95835|LATS1_HUMAN Serine/threonine-protein kinase LATS1 OS=Homo sapiens GN=LATS1 PE=1 SV=1 158 490 5.0E-45
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 158 503 9.0E-45
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 156 407 1.0E-44
sp|P38679|COT1_NEUCR Serine/threonine-protein kinase cot-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cot-1 PE=2 SV=2 78 447 1.0E-44
sp|Q03407|PKH1_YEAST Serine/threonine-protein kinase PKH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH1 PE=1 SV=1 158 450 1.0E-44
sp|P97711|GRK6_RAT G protein-coupled receptor kinase 6 OS=Rattus norvegicus GN=Grk6 PE=2 SV=1 156 450 1.0E-44
sp|Q54L81|Y0700_DICDI Probable serine/threonine-protein kinase DDB_G0286841 OS=Dictyostelium discoideum GN=DDB_G0286841 PE=3 SV=1 162 438 1.0E-44
sp|P32866|GPRK2_DROME G protein-coupled receptor kinase 2 OS=Drosophila melanogaster GN=Gprk2 PE=1 SV=3 159 444 1.0E-44
sp|O70291|GRK4_MOUSE G protein-coupled receptor kinase 4 OS=Mus musculus GN=Grk4 PE=2 SV=2 156 450 2.0E-44
sp|O45797|WARTS_CAEEL Serine/threonine-protein kinase WARTS homolog OS=Caenorhabditis elegans GN=wts-1 PE=1 SV=1 156 455 2.0E-44
sp|Q80UW5|MRCKG_MOUSE Serine/threonine-protein kinase MRCK gamma OS=Mus musculus GN=Cdc42bpg PE=1 SV=2 158 494 2.0E-44
sp|Q5VT25|MRCKA_HUMAN Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens GN=CDC42BPA PE=1 SV=1 158 507 3.0E-44
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 159 408 3.0E-44
sp|Q7TT50|MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus GN=Cdc42bpb PE=1 SV=2 158 496 4.0E-44
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 163 427 4.0E-44
sp|Q9JJX8|ST32B_MOUSE Serine/threonine-protein kinase 32B OS=Mus musculus GN=Stk32b PE=2 SV=2 162 444 4.0E-44
sp|P70507|GRK4_RAT G protein-coupled receptor kinase 4 OS=Rattus norvegicus GN=Grk4 PE=1 SV=1 156 512 4.0E-44
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 158 503 4.0E-44
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 156 407 5.0E-44
sp|O54874|MRCKA_RAT Serine/threonine-protein kinase MRCK alpha OS=Rattus norvegicus GN=Cdc42bpa PE=1 SV=1 158 507 5.0E-44
sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 158 455 5.0E-44
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 156 408 6.0E-44
sp|Q3UU96|MRCKA_MOUSE Serine/threonine-protein kinase MRCK alpha OS=Mus musculus GN=Cdc42bpa PE=1 SV=2 158 507 6.0E-44
sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 159 455 6.0E-44
sp|Q9W1B0|GEK_DROME Serine/threonine-protein kinase Genghis Khan OS=Drosophila melanogaster GN=gek PE=1 SV=1 156 510 6.0E-44
sp|Q09639|GRK2_CAEEL G protein-coupled receptor kinase 2 OS=Caenorhabditis elegans GN=grk-2 PE=3 SV=2 158 444 7.0E-44
sp|Q6DT37|MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens GN=CDC42BPG PE=1 SV=2 158 491 9.0E-44
sp|Q9UQB9|AURKC_HUMAN Aurora kinase C OS=Homo sapiens GN=AURKC PE=1 SV=1 157 445 2.0E-43
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 156 407 3.0E-43
sp|P32298|GRK4_HUMAN G protein-coupled receptor kinase 4 OS=Homo sapiens GN=GRK4 PE=1 SV=3 156 444 7.0E-43
sp|O64682|PID_ARATH Protein kinase PINOID OS=Arabidopsis thaliana GN=PID PE=1 SV=1 156 444 7.0E-43
sp|Q63644|ROCK1_RAT Rho-associated protein kinase 1 OS=Rattus norvegicus GN=Rock1 PE=1 SV=1 158 455 7.0E-43
sp|P70335|ROCK1_MOUSE Rho-associated protein kinase 1 OS=Mus musculus GN=Rock1 PE=1 SV=1 158 455 8.0E-43
sp|Q753D9|PKH3_ASHGO Serine/threonine-protein kinase PKH3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PKH3 PE=3 SV=1 170 434 9.0E-43
sp|Q13464|ROCK1_HUMAN Rho-associated protein kinase 1 OS=Homo sapiens GN=ROCK1 PE=1 SV=1 158 455 1.0E-42
sp|Q96GD4|AURKB_HUMAN Aurora kinase B OS=Homo sapiens GN=AURKB PE=1 SV=3 157 441 1.0E-42
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 160 497 1.0E-42
sp|O77819|ROCK1_RABIT Rho-associated protein kinase 1 OS=Oryctolagus cuniculus GN=ROCK1 PE=1 SV=1 158 455 1.0E-42
sp|Q8WU08|ST32A_HUMAN Serine/threonine-protein kinase 32A OS=Homo sapiens GN=STK32A PE=1 SV=2 162 444 2.0E-42
sp|Q9NY57|ST32B_HUMAN Serine/threonine-protein kinase 32B OS=Homo sapiens GN=STK32B PE=2 SV=1 162 444 2.0E-42
sp|P21901|KAPL_APLCA Spermatozoon-associated protein kinase OS=Aplysia californica PE=2 SV=1 146 465 2.0E-42
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 155 409 4.0E-42
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 156 409 4.0E-42
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 158 427 4.0E-42
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 151 441 4.0E-42
sp|P28327|RK_BOVIN Rhodopsin kinase OS=Bos taurus GN=GRK1 PE=1 SV=1 159 444 5.0E-42
sp|P26818|ARBK2_BOVIN Beta-adrenergic receptor kinase 2 OS=Bos taurus GN=ADRBK2 PE=2 SV=1 159 444 1.0E-41
sp|Q09537|GRK1_CAEEL G protein-coupled receptor kinase 1 OS=Caenorhabditis elegans GN=grk-1 PE=3 SV=1 156 444 1.0E-41
sp|P16911|KDC1_DROME Protein kinase DC1 OS=Drosophila melanogaster GN=Pka-C2 PE=2 SV=1 170 407 2.0E-41
sp|Q09898|SID2_SCHPO Serine/threonine-protein kinase sid2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid2 PE=1 SV=1 156 490 2.0E-41
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 156 408 2.0E-41
sp|Q9Y7J6|PPK21_SCHPO Serine/threonine-protein kinase ppk21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk21 PE=1 SV=3 169 459 3.0E-41
sp|P92199|ROCK_CAEEL Rho-associated protein kinase let-502 OS=Caenorhabditis elegans GN=let-502 PE=1 SV=1 131 444 3.0E-41
sp|Q8BGW6|ST32A_MOUSE Serine/threonine-protein kinase 32A OS=Mus musculus GN=Stk32a PE=2 SV=1 162 444 4.0E-41
sp|Q54HD2|NDRD_DICDI Probable serine/threonine-protein kinase ndrD OS=Dictyostelium discoideum GN=ndrD PE=3 SV=1 145 498 4.0E-41
sp|Q622Z7|GRK1_CAEBR G protein-coupled receptor kinase 1 OS=Caenorhabditis briggsae GN=grk-1 PE=3 SV=1 156 444 5.0E-41
sp|O62846|KAPCG_MACMU cAMP-dependent protein kinase catalytic subunit gamma (Fragment) OS=Macaca mulatta GN=PRKACG PE=2 SV=3 154 336 5.0E-41
sp|Q9WVL4|RK_MOUSE Rhodopsin kinase OS=Mus musculus GN=Grk1 PE=1 SV=1 164 444 6.0E-41
sp|P25098|ARBK1_HUMAN Beta-adrenergic receptor kinase 1 OS=Homo sapiens GN=ADRBK1 PE=1 SV=2 159 444 6.0E-41
sp|P26817|ARBK1_RAT Beta-adrenergic receptor kinase 1 OS=Rattus norvegicus GN=Adrbk1 PE=1 SV=1 159 444 7.0E-41
sp|P21146|ARBK1_BOVIN Beta-adrenergic receptor kinase 1 OS=Bos taurus GN=ADRBK1 PE=1 SV=1 159 444 8.0E-41
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 167 490 8.0E-41
sp|P22204|DBF2_YEAST Cell cycle protein kinase DBF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF2 PE=1 SV=3 153 460 9.0E-41
sp|Q8QZV4|ST32C_MOUSE Serine/threonine-protein kinase 32C OS=Mus musculus GN=Stk32c PE=1 SV=1 153 444 9.0E-41
sp|Q15835|RK_HUMAN Rhodopsin kinase OS=Homo sapiens GN=GRK1 PE=1 SV=1 159 444 1.0E-40
sp|Q99MK8|ARBK1_MOUSE Beta-adrenergic receptor kinase 1 OS=Mus musculus GN=Adrbk1 PE=1 SV=2 159 444 1.0E-40
sp|Q86UX6|ST32C_HUMAN Serine/threonine-protein kinase 32C OS=Homo sapiens GN=STK32C PE=1 SV=1 153 444 1.0E-40
sp|Q8WP15|GRK7_PIG G protein-coupled receptor kinase 7 OS=Sus scrofa GN=GRK7 PE=1 SV=1 159 444 1.0E-40
sp|O75116|ROCK2_HUMAN Rho-associated protein kinase 2 OS=Homo sapiens GN=ROCK2 PE=1 SV=4 158 455 1.0E-40
sp|Q63450|KCC1A_RAT Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus GN=Camk1 PE=1 SV=2 170 408 1.0E-40
sp|Q91YS8|KCC1A_MOUSE Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus GN=Camk1 PE=1 SV=1 170 408 2.0E-40
sp|Q8BW96|KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus GN=Camk1d PE=1 SV=2 164 407 2.0E-40
sp|A8WVU9|ROCK_CAEBR Rho-associated protein kinase let-502 OS=Caenorhabditis briggsae GN=let-502 PE=3 SV=2 131 444 2.0E-40
sp|Q63651|RK_RAT Rhodopsin kinase OS=Rattus norvegicus GN=Grk1 PE=1 SV=1 164 444 2.0E-40
sp|Q14012|KCC1A_HUMAN Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens GN=CAMK1 PE=1 SV=1 170 408 2.0E-40
sp|P35626|ARBK2_HUMAN Beta-adrenergic receptor kinase 2 OS=Homo sapiens GN=ADRBK2 PE=1 SV=2 159 444 2.0E-40
sp|Q09013|DMPK_HUMAN Myotonin-protein kinase OS=Homo sapiens GN=DMPK PE=1 SV=3 158 479 3.0E-40
sp|B6CZ17|GRK7A_XENLA G protein-coupled receptor kinase 7A OS=Xenopus laevis GN=grk7-a PE=1 SV=1 156 463 3.0E-40
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 164 427 3.0E-40
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 155 408 4.0E-40
sp|Q8WMV0|GRK7_BOVIN G protein-coupled receptor kinase 7 OS=Bos taurus GN=GRK7 PE=1 SV=1 159 462 4.0E-40
sp|P54265|DMPK_MOUSE Myotonin-protein kinase OS=Mus musculus GN=Dmpk PE=1 SV=1 158 494 6.0E-40
sp|Q54P47|NDRC_DICDI Probable serine/threonine-protein kinase ndrC OS=Dictyostelium discoideum GN=ndrC PE=3 SV=1 154 446 7.0E-40
sp|Q8IU85|KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens GN=CAMK1D PE=1 SV=1 164 407 7.0E-40
sp|Q9Z2G7|GRK7_ICTTR G protein-coupled receptor kinase 7 OS=Ictidomys tridecemlineatus GN=GRK7 PE=1 SV=1 149 444 1.0E-39
sp|M3TYT0|ROCK2_PIG Rho-associated protein kinase 2 OS=Sus scrofa GN=ROCK2 PE=1 SV=1 158 455 1.0E-39
sp|Q28021|ROCK2_BOVIN Rho-associated protein kinase 2 OS=Bos taurus GN=ROCK2 PE=1 SV=1 158 455 1.0E-39
sp|P70336|ROCK2_MOUSE Rho-associated protein kinase 2 OS=Mus musculus GN=Rock2 PE=1 SV=1 158 455 2.0E-39
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 167 432 2.0E-39
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 167 432 2.0E-39
sp|B6CZ18|GRK7B_XENLA G protein-coupled receptor kinase 7B OS=Xenopus laevis GN=grk7-b PE=1 SV=1 156 444 2.0E-39
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 169 444 3.0E-39
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 167 432 5.0E-39
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 149 441 5.0E-39
sp|Q8VHF0|MARK3_RAT MAP/microtubule affinity-regulating kinase 3 OS=Rattus norvegicus GN=Mark3 PE=1 SV=1 167 407 5.0E-39
sp|Q64682|ARBK1_MESAU Beta-adrenergic receptor kinase 1 OS=Mesocricetus auratus GN=ADRBK1 PE=2 SV=1 159 444 6.0E-39
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 157 430 8.0E-39
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 163 433 9.0E-39
sp|O97627|ARBK1_DIDVI Beta-adrenergic receptor kinase 1 OS=Didelphis virginiana GN=ADRBK1 PE=1 SV=1 159 444 1.0E-38
sp|P26819|ARBK2_RAT Beta-adrenergic receptor kinase 2 OS=Rattus norvegicus GN=Adrbk2 PE=2 SV=1 159 444 2.0E-38
sp|Q3UYH7|ARBK2_MOUSE Beta-adrenergic receptor kinase 2 OS=Mus musculus GN=Adrbk2 PE=1 SV=2 159 444 2.0E-38
sp|Q03141|MARK3_MOUSE MAP/microtubule affinity-regulating kinase 3 OS=Mus musculus GN=Mark3 PE=1 SV=2 167 407 3.0E-38
sp|Q9NRH2|SNRK_HUMAN SNF-related serine/threonine-protein kinase OS=Homo sapiens GN=SNRK PE=1 SV=2 168 429 3.0E-38
sp|O08679|MARK2_RAT Serine/threonine-protein kinase MARK2 OS=Rattus norvegicus GN=Mark2 PE=1 SV=1 167 465 3.0E-38
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 154 427 4.0E-38
sp|Q9FMP5|CDPKH_ARATH Calcium-dependent protein kinase 17 OS=Arabidopsis thaliana GN=CPK17 PE=2 SV=1 170 408 4.0E-38
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 156 408 5.0E-38
sp|Q8WTQ7|GRK7_HUMAN G protein-coupled receptor kinase 7 OS=Homo sapiens GN=GRK7 PE=1 SV=1 149 462 5.0E-38
sp|Q62868|ROCK2_RAT Rho-associated protein kinase 2 OS=Rattus norvegicus GN=Rock2 PE=1 SV=2 158 455 5.0E-38
sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase OS=Daucus carota PE=2 SV=2 170 415 5.0E-38
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 150 421 5.0E-38
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 163 444 6.0E-38
sp|Q7KZI7|MARK2_HUMAN Serine/threonine-protein kinase MARK2 OS=Homo sapiens GN=MARK2 PE=1 SV=2 167 453 6.0E-38
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 163 439 7.0E-38
sp|Q60670|SIK1_MOUSE Serine/threonine-protein kinase SIK1 OS=Mus musculus GN=Sik1 PE=1 SV=3 168 426 7.0E-38
sp|Q9IA88|SIK2_CHICK Serine/threonine-protein kinase SIK2 OS=Gallus gallus GN=SIK2 PE=2 SV=1 168 426 7.0E-38
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 163 444 8.0E-38
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 167 407 1.0E-37
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 167 407 1.0E-37
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 163 427 1.0E-37
sp|Q9R1U5|SIK1_RAT Serine/threonine-protein kinase SIK1 OS=Rattus norvegicus GN=Sik1 PE=1 SV=1 168 426 1.0E-37
sp|P32328|DBF20_YEAST Serine/threonine-protein kinase DBF20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBF20 PE=1 SV=2 153 460 1.0E-37
sp|P27448|MARK3_HUMAN MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens GN=MARK3 PE=1 SV=4 164 407 1.0E-37
sp|D7UQM5|AURK_PATPE Aurora kinase OS=Patiria pectinifera GN=aur PE=1 SV=1 158 408 1.0E-37
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 162 408 1.0E-37
sp|Q9ZSA2|CDPKL_ARATH Calcium-dependent protein kinase 21 OS=Arabidopsis thaliana GN=CPK21 PE=1 SV=1 170 429 1.0E-37
sp|Q63553|SNRK_RAT SNF-related serine/threonine-protein kinase OS=Rattus norvegicus GN=Snrk PE=1 SV=1 168 407 2.0E-37
sp|Q8VDU5|SNRK_MOUSE SNF-related serine/threonine-protein kinase OS=Mus musculus GN=Snrk PE=1 SV=1 168 407 2.0E-37
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 160 490 2.0E-37
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 163 408 2.0E-37
sp|Q42479|CDPK3_ARATH Calcium-dependent protein kinase 3 OS=Arabidopsis thaliana GN=CPK3 PE=1 SV=1 164 408 2.0E-37
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 162 408 2.0E-37
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 153 427 3.0E-37
sp|Q8RWL2|CDPKT_ARATH Calcium-dependent protein kinase 29 OS=Arabidopsis thaliana GN=CPK29 PE=2 SV=2 170 408 4.0E-37
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 168 408 4.0E-37
sp|Q3E9C0|CDPKY_ARATH Calcium-dependent protein kinase 34 OS=Arabidopsis thaliana GN=CPK34 PE=2 SV=1 170 408 4.0E-37
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 170 410 5.0E-37
sp|Q05512|MARK2_MOUSE Serine/threonine-protein kinase MARK2 OS=Mus musculus GN=Mark2 PE=1 SV=3 167 453 7.0E-37
sp|P57059|SIK1_HUMAN Serine/threonine-protein kinase SIK1 OS=Homo sapiens GN=SIK1 PE=1 SV=2 168 426 7.0E-37
sp|Q49HM9|GRK7A_DANRE G-protein-coupled receptor kinase 7A OS=Danio rerio GN=grk7a PE=1 SV=2 156 444 8.0E-37
sp|Q9VWQ2|S6KL_DROME Serine/threonine-protein kinase S6KL OS=Drosophila melanogaster GN=S6KL PE=1 SV=1 170 421 2.0E-36
sp|P38991|IPL1_YEAST Spindle assembly checkpoint kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IPL1 PE=1 SV=1 129 408 2.0E-36
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 163 427 2.0E-36
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 148 408 2.0E-36
sp|Q9VKN7|AURKB_DROME Aurora kinase B OS=Drosophila melanogaster GN=ial PE=1 SV=1 163 411 2.0E-36
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 164 452 3.0E-36
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 153 449 4.0E-36
sp|B4MXR8|PLK4_DROWI Serine/threonine-protein kinase PLK4 OS=Drosophila willistoni GN=SAK PE=3 SV=1 160 427 6.0E-36
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 164 407 6.0E-36
sp|Q1PFH8|CDPKJ_ARATH Calcium-dependent protein kinase 19 OS=Arabidopsis thaliana GN=CPK19 PE=2 SV=1 168 408 7.0E-36
sp|Q501V0|KPSH1_DANRE Serine/threonine-protein kinase H1 homolog OS=Danio rerio GN=pskh1 PE=2 SV=2 170 410 7.0E-36
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 155 408 8.0E-36
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 160 408 8.0E-36
sp|P25323|MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum GN=mlkA PE=1 SV=2 170 439 9.0E-36
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 164 408 1.0E-35
sp|Q42396|CDPKC_ARATH Calcium-dependent protein kinase 12 OS=Arabidopsis thaliana GN=CPK12 PE=1 SV=1 168 408 1.0E-35
sp|Q1XHL7|GRK7B_DANRE G protein-coupled receptor kinase 7B OS=Danio rerio GN=grk7b PE=1 SV=2 156 444 1.0E-35
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 163 413 2.0E-35
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 144 427 2.0E-35
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 164 408 2.0E-35
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 155 408 2.0E-35
sp|B4KYX8|PLK4_DROMO Serine/threonine-protein kinase PLK4 OS=Drosophila mojavensis GN=SAK PE=3 SV=1 160 428 3.0E-35
sp|Q9C6P3|CDPKX_ARATH Calcium-dependent protein kinase 33 OS=Arabidopsis thaliana GN=CPK33 PE=2 SV=1 170 410 3.0E-35
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 154 408 3.0E-35
sp|Q6P2M8|KCC1B_HUMAN Calcium/calmodulin-dependent protein kinase type 1B OS=Homo sapiens GN=PNCK PE=2 SV=2 160 408 3.0E-35
sp|O70150|KCC1B_RAT Calcium/calmodulin-dependent protein kinase type 1B OS=Rattus norvegicus GN=Pnck PE=1 SV=1 153 432 3.0E-35
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 170 407 3.0E-35
sp|Q0V7M1|KPSH1_BOVIN Serine/threonine-protein kinase H1 OS=Bos taurus GN=PSKH1 PE=2 SV=1 170 411 4.0E-35
sp|P11801|KPSH1_HUMAN Serine/threonine-protein kinase H1 OS=Homo sapiens GN=PSKH1 PE=1 SV=4 170 411 5.0E-35
sp|B4IAQ8|PLK4_DROSE Serine/threonine-protein kinase PLK4 OS=Drosophila sechellia GN=SAK PE=3 SV=1 160 408 5.0E-35
sp|Q39016|CDPKB_ARATH Calcium-dependent protein kinase 11 OS=Arabidopsis thaliana GN=CPK11 PE=1 SV=2 170 410 5.0E-35
sp|Q38869|CDPK4_ARATH Calcium-dependent protein kinase 4 OS=Arabidopsis thaliana GN=CPK4 PE=1 SV=1 170 410 5.0E-35
sp|Q9QYK9|KCC1B_MOUSE Calcium/calmodulin-dependent protein kinase type 1B OS=Mus musculus GN=Pnck PE=1 SV=1 153 408 5.0E-35
sp|O49717|CDPKF_ARATH Calcium-dependent protein kinase 15 OS=Arabidopsis thaliana GN=CPK15 PE=2 SV=1 170 429 5.0E-35
sp|Q42438|CDPK8_ARATH Calcium-dependent protein kinase 8 OS=Arabidopsis thaliana GN=CPK8 PE=1 SV=1 133 410 5.0E-35
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 161 400 6.0E-35
sp|B4LDJ6|PLK4_DROVI Serine/threonine-protein kinase PLK4 OS=Drosophila virilis GN=SAK PE=3 SV=1 160 427 7.0E-35
sp|Q91YA2|KPSH1_MOUSE Serine/threonine-protein kinase H1 OS=Mus musculus GN=Pskh1 PE=2 SV=3 170 411 7.0E-35
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 161 400 7.0E-35
sp|O97143|PLK4_DROME Serine/threonine-protein kinase PLK4 OS=Drosophila melanogaster GN=SAK PE=1 SV=1 160 408 7.0E-35
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 163 408 8.0E-35
sp|B4QK53|PLK4_DROSI Serine/threonine-protein kinase PLK4 OS=Drosophila simulans GN=SAK PE=3 SV=1 160 408 8.0E-35
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 163 408 1.0E-34
sp|Q8VHJ5|MARK1_MOUSE Serine/threonine-protein kinase MARK1 OS=Mus musculus GN=Mark1 PE=1 SV=2 168 407 1.0E-34
sp|Q38868|CDPK9_ARATH Calcium-dependent protein kinase 9 OS=Arabidopsis thaliana GN=CPK9 PE=1 SV=1 152 429 1.0E-34
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 163 416 1.0E-34
sp|Q8MYQ1|Y31E_CAEEL Putative serine/threonine-protein kinase F31E3.2 OS=Caenorhabditis elegans GN=F31E3.2 PE=3 SV=1 155 440 1.0E-34
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 164 408 1.0E-34
sp|O08678|MARK1_RAT Serine/threonine-protein kinase MARK1 OS=Rattus norvegicus GN=Mark1 PE=1 SV=1 168 407 2.0E-34
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 163 408 2.0E-34
sp|P49101|CDPK2_MAIZE Calcium-dependent protein kinase 2 OS=Zea mays GN=CPK2 PE=2 SV=1 170 410 2.0E-34
sp|B4PDM5|PLK4_DROYA Serine/threonine-protein kinase PLK4 OS=Drosophila yakuba GN=SAK PE=3 SV=1 160 408 2.0E-34
sp|Q00771|KCC1_EMENI Calcium/calmodulin-dependent protein kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cmkA PE=2 SV=2 168 407 2.0E-34
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 168 408 2.0E-34
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 164 427 2.0E-34
sp|Q54SJ5|MYLKC_DICDI Probable myosin light chain kinase DDB_G0282429 OS=Dictyostelium discoideum GN=DDB_G0282429 PE=3 SV=1 170 408 2.0E-34
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 170 409 3.0E-34
sp|B3NE99|PLK4_DROER Serine/threonine-protein kinase PLK4 OS=Drosophila erecta GN=SAK PE=3 SV=1 160 408 3.0E-34
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 160 427 3.0E-34
sp|O74426|PPK33_SCHPO Serine/threonine-protein kinase ppk33 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk33 PE=3 SV=1 163 451 3.0E-34
sp|Q9P7I2|KCC1_SCHPO Calcium/calmodulin-dependent protein kinase type I OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cmk1 PE=1 SV=1 168 410 3.0E-34
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 164 408 4.0E-34
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 163 408 4.0E-34
sp|Q8IBS5|CDPK4_PLAF7 Calcium-dependent protein kinase 4 OS=Plasmodium falciparum (isolate 3D7) GN=CPK4 PE=1 SV=3 161 400 4.0E-34
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 151 440 4.0E-34
sp|Q4KTY1|KPSH1_PINFU Serine/threonine-protein kinase H1 homolog OS=Pinctada fucata GN=PSKH1 PE=2 SV=1 154 410 4.0E-34
sp|P62343|CDPK1_PLAFK Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK1 PE=1 SV=2 162 408 4.0E-34
sp|P62344|CDPK1_PLAF7 Calcium-dependent protein kinase 1 OS=Plasmodium falciparum (isolate 3D7) GN=CPK1 PE=3 SV=2 162 408 4.0E-34
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 163 408 4.0E-34
sp|Q06850|CDPK1_ARATH Calcium-dependent protein kinase 1 OS=Arabidopsis thaliana GN=CPK1 PE=1 SV=1 43 408 5.0E-34
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 170 409 5.0E-34
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 164 427 6.0E-34
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 156 427 7.0E-34
sp|Q9P0L2|MARK1_HUMAN Serine/threonine-protein kinase MARK1 OS=Homo sapiens GN=MARK1 PE=1 SV=2 168 407 7.0E-34
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 170 407 8.0E-34
sp|O44997|DAPK_CAEEL Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 170 407 8.0E-34
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 142 407 1.0E-33
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 170 407 1.0E-33
sp|P53683|CDPK2_ORYSJ Calcium-dependent protein kinase isoform 2 OS=Oryza sativa subsp. japonica GN=CPK2 PE=2 SV=2 170 429 1.0E-33
sp|Q9ZV15|CDPKK_ARATH Calcium-dependent protein kinase 20 OS=Arabidopsis thaliana GN=CPK20 PE=3 SV=1 168 408 1.0E-33
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 154 427 1.0E-33
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 156 312 1.0E-33
sp|O75582|KS6A5_HUMAN Ribosomal protein S6 kinase alpha-5 OS=Homo sapiens GN=RPS6KA5 PE=1 SV=1 170 408 7.0E-31
sp|Q5R4K3|KS6A5_PONAB Ribosomal protein S6 kinase alpha-5 OS=Pongo abelii GN=RPS6KA5 PE=2 SV=1 170 408 2.0E-30
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 170 408 1.0E-28
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 169 408 4.0E-28
sp|Q18846|KS6A2_CAEEL Putative ribosomal protein S6 kinase alpha-2 OS=Caenorhabditis elegans GN=rskn-2 PE=3 SV=2 170 408 5.0E-27
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 121 408 4.0E-26
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 169 408 2.0E-25
sp|Q8C050|KS6A5_MOUSE Ribosomal protein S6 kinase alpha-5 OS=Mus musculus GN=Rps6ka5 PE=1 SV=2 227 408 3.0E-24
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 169 408 7.0E-22
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 153 408 2.0E-21
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 153 408 4.0E-21
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 164 456 1.0E-20
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 164 456 1.0E-20
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 205 408 1.0E-20
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 170 411 4.0E-19
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 169 408 9.0E-19
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 205 407 1.0E-18
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 161 407 3.0E-18
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 205 407 3.0E-18
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 170 411 5.0E-18
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 170 365 5.0E-17
sp|Q6BLJ9|CBK1_DEBHA Serine/threonine-protein kinase CBK1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CBK1 PE=3 SV=2 324 502 6.0E-14
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 217 366 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004672 protein kinase activity Yes
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0043412 macromolecule modification No
GO:0030554 adenyl nucleotide binding No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0016301 kinase activity No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0043170 macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0044237 cellular metabolic process No
GO:0016310 phosphorylation No
GO:0003674 molecular_function No
GO:0006796 phosphate-containing compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0016740 transferase activity No
GO:0043168 anion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0044238 primary metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006807 nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7831 0.4081 0.0201 0.2993 0.128 0.0414 0.0963 0.2112 0.1631 0.0129

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5036
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5316
Ophiocordyceps australis map64 (Brazil) OphauB2|2139
Ophiocordyceps camponoti-floridani Ophcf2|00281
Ophiocordyceps camponoti-rufipedis Ophun1|4284
Ophiocordyceps kimflemingae Ophio5|8148
Ophiocordyceps subramaniannii Hirsu2|2610 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2610
MIGPAPPALTTVRGFQGTPVTSGDEDSDSGVCDTPRLPGHRGRHRLDDVVSANCSPVLRALPSPGVSGIAKLRMQ
MEPLSLDGSSRCSSLARNLPPSSLASRSHSRDGTRSEAGSDSSDNASTGYEVRLEDDFVSESVRVRGSGHMEALE
GGLNPKRKMTSEEFEPLRCLGKGTFGTVVLVKQRATGRLYAQKQFRKASLVVHKKLVEQTKTERQILESVNRHPF
VVKLFYAFQDHEKLYLILEYGQGGELFTHLNTEKMFSETVAAFYMAEMLLAISHLHNDLGVVYRDLKPENCLLDA
DGHLLLTDFGLSKVAVEPSESCESMLGTVEYMAPEVILGKRYGKAVDWWSFGALGYDLMTGNPPFRGANHAKVQD
KIVRQKLVLPYFLSADAKDLLTRLMRKDPNKRLGSVMPRDLVALKRHRFFRKIDWRRLEARELEPPIQPMITDPE
LAENFAPEFTELSLSPATAAAAGGGASGSHKDDVFGGFSFVASSSLLESNAFAMANGGGDGGD*
Coding >Hirsu2|2610
ATGATAGGCCCGGCCCCTCCGGCGCTCACGACGGTGCGCGGCTTCCAGGGCACGCCCGTCACCTCGGGCGACGAG
GACTCCGACTCGGGCGTCTGCGACACGCCGCGCCTGCCCGGCCACCGGGGCCGCCACCGGCTGGACGATGTTGTC
AGCGCCAACTGCAGCCCGGTGCTCCGTGCGCTGCCGTCGCCCGGCGTGTCGGGCATCGCCAAGCTGCGGATGCAG
ATGGAGCCGCTGAGCCTGGACGGGTCGTCGCGCTGCAGCTCGCTGGCGCGCAACCTGCCGCCCAGCTCGCTGGCC
AGCCGGTCGCACAGCCGCGACGGCACGCGCAGCGAGGCCGGCAGCGACAGCTCGGACAACGCGTCGACAGGGTAC
GAGGTGAGGCTCGAGGACGACTTCGTCAGCGAGAGCGTCCGCGTGCGCGGGTCCGGCCACATGGAGGCGCTCGAG
GGGGGCCTGAACCCGAAGCGCAAGATGACGTCGGAGGAGTTCGAGCCGCTGCGCTGCCTGGGCAAGGGCACCTTC
GGCACGGTGGTGCTGGTCAAGCAGCGGGCGACGGGCCGGCTGTACGCGCAGAAGCAGTTCCGCAAGGCGTCGCTG
GTGGTGCACAAGAAGCTGGTCGAGCAGACCAAGACGGAGCGGCAGATCCTCGAGTCGGTCAACCGGCACCCGTTC
GTGGTCAAGCTGTTCTACGCCTTCCAGGACCACGAGAAGCTGTACCTGATCCTCGAGTACGGGCAGGGCGGGGAG
CTGTTCACGCACCTCAACACGGAGAAGATGTTCTCGGAGACGGTGGCGGCCTTCTACATGGCGGAGATGCTGCTG
GCCATCTCGCACCTGCACAACGACCTGGGCGTCGTGTACCGCGACCTGAAGCCGGAGAACTGCCTGCTGGACGCC
GACGGGCACCTGCTGCTGACCGACTTCGGCCTGTCCAAGGTGGCGGTGGAGCCGTCGGAGAGCTGCGAGTCGATG
CTCGGCACGGTCGAGTACATGGCGCCCGAGGTGATACTGGGCAAGCGGTACGGCAAGGCGGTGGACTGGTGGTCG
TTTGGCGCGCTGGGCTACGACCTGATGACGGGCAACCCGCCGTTCCGGGGCGCGAACCACGCCAAGGTGCAGGAC
AAGATCGTGCGGCAGAAGCTGGTGCTGCCCTACTTCCTCAGCGCCGACGCCAAGGACCTGCTGACGCGGCTGATG
CGCAAGGACCCCAACAAGCGGCTGGGGTCGGTGATGCCGCGGGACCTGGTGGCCCTGAAGCGGCACCGCTTCTTC
CGCAAGATCGACTGGCGCCGGCTCGAGGCGCGCGAGCTGGAGCCGCCCATCCAGCCCATGATCACGGACCCGGAG
CTGGCCGAGAACTTTGCGCCCGAGTTCACGGAGCTGTCGCTGAGCCCCGCCACGGCGGCGGCGGCCGGCGGGGGC
GCGTCGGGCAGCCACAAGGACGACGTCTTTGGCGGCTTCAGCTTCGTCGCGTCGAGCAGCCTGCTGGAGAGCAAC
GCGTTTGCCATGGCCAATGGCGGCGGCGACGGCGGCGACTGA
Transcript >Hirsu2|2610
ATGATAGGCCCGGCCCCTCCGGCGCTCACGACGGTGCGCGGCTTCCAGGGCACGCCCGTCACCTCGGGCGACGAG
GACTCCGACTCGGGCGTCTGCGACACGCCGCGCCTGCCCGGCCACCGGGGCCGCCACCGGCTGGACGATGTTGTC
AGCGCCAACTGCAGCCCGGTGCTCCGTGCGCTGCCGTCGCCCGGCGTGTCGGGCATCGCCAAGCTGCGGATGCAG
ATGGAGCCGCTGAGCCTGGACGGGTCGTCGCGCTGCAGCTCGCTGGCGCGCAACCTGCCGCCCAGCTCGCTGGCC
AGCCGGTCGCACAGCCGCGACGGCACGCGCAGCGAGGCCGGCAGCGACAGCTCGGACAACGCGTCGACAGGGTAC
GAGGTGAGGCTCGAGGACGACTTCGTCAGCGAGAGCGTCCGCGTGCGCGGGTCCGGCCACATGGAGGCGCTCGAG
GGGGGCCTGAACCCGAAGCGCAAGATGACGTCGGAGGAGTTCGAGCCGCTGCGCTGCCTGGGCAAGGGCACCTTC
GGCACGGTGGTGCTGGTCAAGCAGCGGGCGACGGGCCGGCTGTACGCGCAGAAGCAGTTCCGCAAGGCGTCGCTG
GTGGTGCACAAGAAGCTGGTCGAGCAGACCAAGACGGAGCGGCAGATCCTCGAGTCGGTCAACCGGCACCCGTTC
GTGGTCAAGCTGTTCTACGCCTTCCAGGACCACGAGAAGCTGTACCTGATCCTCGAGTACGGGCAGGGCGGGGAG
CTGTTCACGCACCTCAACACGGAGAAGATGTTCTCGGAGACGGTGGCGGCCTTCTACATGGCGGAGATGCTGCTG
GCCATCTCGCACCTGCACAACGACCTGGGCGTCGTGTACCGCGACCTGAAGCCGGAGAACTGCCTGCTGGACGCC
GACGGGCACCTGCTGCTGACCGACTTCGGCCTGTCCAAGGTGGCGGTGGAGCCGTCGGAGAGCTGCGAGTCGATG
CTCGGCACGGTCGAGTACATGGCGCCCGAGGTGATACTGGGCAAGCGGTACGGCAAGGCGGTGGACTGGTGGTCG
TTTGGCGCGCTGGGCTACGACCTGATGACGGGCAACCCGCCGTTCCGGGGCGCGAACCACGCCAAGGTGCAGGAC
AAGATCGTGCGGCAGAAGCTGGTGCTGCCCTACTTCCTCAGCGCCGACGCCAAGGACCTGCTGACGCGGCTGATG
CGCAAGGACCCCAACAAGCGGCTGGGGTCGGTGATGCCGCGGGACCTGGTGGCCCTGAAGCGGCACCGCTTCTTC
CGCAAGATCGACTGGCGCCGGCTCGAGGCGCGCGAGCTGGAGCCGCCCATCCAGCCCATGATCACGGACCCGGAG
CTGGCCGAGAACTTTGCGCCCGAGTTCACGGAGCTGTCGCTGAGCCCCGCCACGGCGGCGGCGGCCGGCGGGGGC
GCGTCGGGCAGCCACAAGGACGACGTCTTTGGCGGCTTCAGCTTCGTCGCGTCGAGCAGCCTGCTGGAGAGCAAC
GCGTTTGCCATGGCCAATGGCGGCGGCGACGGCGGCGACTGA
Gene >Hirsu2|2610
ATGATAGGCCCGGCCCCTCCGGCGCTCACGACGGTGCGCGGCTTCCAGGGCACGCCCGTCACCTCGGGCGACGAG
GACTCCGACTCGGGCGTCTGCGACACGCCGCGCCTGCCCGGCCACCGGGGCCGCCACCGGCTGGACGATGTTGTC
AGCGCCAACTGCAGCCCGGTGCTCCGTGCGCTGCCGTCGCCCGGCGTGTCGGGCATCGCCAAGCTGCGGATGCAG
ATGGAGCCGCTGAGCCTGGACGGGTCGTCGCGCTGCAGCTCGCTGGCGCGCAACCTGCCGCCCAGCTCGCTGGCC
AGCCGGTCGCACAGCCGCGACGGCACGCGCAGCGAGGCCGGCAGCGACAGCTCGGACAACGCGTCGACAGGGTAC
GAGGTGAGGCTCGAGGACGACTTCGTCAGCGAGAGCGTCCGCGTGCGCGGGTCCGGCCACATGGAGGCGCTCGAG
GGGGGCCTGAACCCGAAGCGCAAGATGACGTCGGAGGAGTTCGAGCCGCTGCGCTGCCTGGGCAAGGGCACCTTC
GGCACGGTGGTGCTGGTCAAGCAGCGGGCGACGGGCCGGCTGTACGCGCAGAAGCAGTTCCGCAAGGCGTCGCTG
GTGGTGCACAAGAAGCTGGTCGAGCAGACCAAGACGGAGCGGCAGATCCTCGAGTCGGTCAACCGGCACCCGTTC
GTGGTCAAGCTGTTCTACGCCTTCCAGGACCACGAGAAGCTGTACCTGATCCTCGAGTACGGGCAGGGCGGGGAG
CTGTTCACGCACCTCAACACGGAGAAGATGTTCTCGGAGACGGTGGCGGCCTTCTACATGGCGGAGATGCTGCTG
GCCATCTCGCACCTGCACAACGACCTGGGCGTCGTGTACCGCGACCTGAAGCCGGAGAACTGCCTGCTGGACGCC
GACGGGCACCTGCTGCTGACCGACTTCGGCCTGTCCAAGGTGGCGGTGGAGCCGTCGGAGAGCTGCGAGTCGATG
CTCGGCACGGTCGAGTACATGGCGCCCGAGGTGATACTGGGCAAGCGGTACGGCAAGGCGGTGGACTGGTGGTCG
TTTGGCGCGCTGGGCTACGACCTGATGACGGGCAACCCGCCGTTCCGGGGCGCGAACCACGCCAAGGTGCAGGAC
AAGATCGTGCGGCAGAAGCTGGTGCTGCCCTACTTCCTCAGCGCCGACGCCAAGGACCTGCTGACGCGGCTGATG
CGCAAGGACCCCAACAAGCGGCTGGGGTCGGTGATGCCGCGGGACCTGGTGGCCCTGAAGCGGCACCGCTTCTTC
CGCAAGATCGACTGGCGCCGGCTCGAGGCGCGCGAGCTGGAGCCGCCCATCCAGCCCATGATCACGGACCCGGAG
CTGGCCGAGAACTTTGCGCCCGAGTTCACGGAGCTGTCGCTGAGCCCCGCCACGGCGGCGGCGGCCGGCGGGGGC
GCGTCGGGCAGCCACAAGGACGACGTCTTTGGCGGCTTCAGCTTCGTCGCGTCGAGCAGCCTGCTGGAGAGCAAC
GCGTTTGCCATGGCCAATGGCGGCGGCGACGGCGGCGACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail