Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2607
Gene name
LocationContig_163:6475..7739
Strand-
Gene length (bp)1264
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16010 CDH-cyt Cytochrome domain of cellobiose dehydrogenase 2.8E-22 30 180
PF03351 DOMON DOMON domain 2.5E-09 47 127

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 218 240 22
2 247 264 17
3 274 296 22
4 309 331 22
5 341 363 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2607
MRLNHQTAIAAAAALGATGASGASAPFCPESQVCFRWGIPQNAATSARGTVYFQLRAPTEYRWVGLGIGSQMRGA
DMFVMYAAGNNNVTLSTRQGQGHTMPQYSARNDVQLMAGSGISNGQMTANVRCTGCDKLDPSGSSDWIAAWLEGS
PMNSASPSERIAIHGGYDGFSVDLSKATVQSNQNPFQGGQGGAQVVGGGTTSGGGGGPSLGFAHGVVMAIIFLIG
YPVGSMLMPLVGSWLLHASWQMLTFLGMWAGFGIGYVITQRANAFFVGTHVQFGVILCCLMCLQPVFGWFHHRYF
VQHQQRGIVSYVHIFYGRSLMALGVINGGLGLKLAGGSGSFVTAYSVIAAIVFVAYILSAVYATFRKRRRVSTET
PKLRLQSI*
Coding >Hirsu2|2607
ATGAGGCTCAATCACCAGACAGCCATCGCGGCCGCGGCCGCCCTCGGCGCGACCGGGGCCTCTGGCGCATCGGCG
CCCTTCTGCCCCGAATCCCAGGTCTGCTTCCGCTGGGGAATTCCGCAAAACGCCGCCACTTCGGCCCGCGGCACC
GTCTACTTCCAGCTTCGCGCGCCGACCGAATACCGGTGGGTCGGCCTCGGTATCGGATCCCAGATGCGCGGCGCC
GACATGTTCGTCATGTACGCTGCCGGCAACAACAACGTGACGCTCAGCACCAGGCAGGGCCAGGGGCACACCATG
CCTCAGTACAGCGCGAGGAACGACGTCCAGCTCATGGCCGGCTCCGGCATCAGCAACGGCCAGATGACGGCCAAC
GTTCGCTGCACCGGCTGCGACAAGCTCGACCCATCGGGTTCGTCCGACTGGATAGCCGCTTGGCTCGAGGGTAGC
CCAATGAACTCGGCCAGCCCGTCGGAGCGCATCGCCATCCACGGCGGCTATGACGGCTTCTCCGTCGACCTCTCC
AAGGCCACTGTCCAGTCCAACCAGAACCCGTTCCAGGGAGGCCAGGGCGGAGCCCAGGTCGTCGGCGGCGGTACC
ACCTCTGGCGGTGGCGGAGGGCCGTCTCTGGGATTTGCCCACGGCGTCGTCATGGCCATCATCTTCCTCATCGGA
TATCCCGTCGGATCCATGCTGATGCCCCTGGTCGGCAGCTGGCTTCTACACGCCAGCTGGCAAATGCTCACCTTC
CTGGGCATGTGGGCGGGCTTCGGTATCGGATATGTCATCACCCAGAGAGCCAATGCTTTCTTCGTCGGTACCCAT
GTCCAATTTGGCGTCATCCTCTGCTGCCTCATGTGCCTGCAGCCCGTCTTCGGCTGGTTCCATCACAGATATTTC
GTCCAGCATCAGCAGCGCGGCATCGTCAGCTACGTACACATCTTTTACGGCCGTTCTCTCATGGCCCTGGGCGTC
ATCAACGGAGGATTGGGCCTGAAGCTCGCCGGCGGCTCCGGCTCCTTCGTCACGGCGTACAGCGTTATAGCTGCC
ATCGTTTTCGTGGCATACATCTTGTCTGCCGTGTACGCCACATTCAGGAAGAGGCGCCGGGTTAGCACCGAGACG
CCGAAGCTTCGACTGCAGTCCATCTGA
Transcript >Hirsu2|2607
ATGAGGCTCAATCACCAGACAGCCATCGCGGCCGCGGCCGCCCTCGGCGCGACCGGGGCCTCTGGCGCATCGGCG
CCCTTCTGCCCCGAATCCCAGGTCTGCTTCCGCTGGGGAATTCCGCAAAACGCCGCCACTTCGGCCCGCGGCACC
GTCTACTTCCAGCTTCGCGCGCCGACCGAATACCGGTGGGTCGGCCTCGGTATCGGATCCCAGATGCGCGGCGCC
GACATGTTCGTCATGTACGCTGCCGGCAACAACAACGTGACGCTCAGCACCAGGCAGGGCCAGGGGCACACCATG
CCTCAGTACAGCGCGAGGAACGACGTCCAGCTCATGGCCGGCTCCGGCATCAGCAACGGCCAGATGACGGCCAAC
GTTCGCTGCACCGGCTGCGACAAGCTCGACCCATCGGGTTCGTCCGACTGGATAGCCGCTTGGCTCGAGGGTAGC
CCAATGAACTCGGCCAGCCCGTCGGAGCGCATCGCCATCCACGGCGGCTATGACGGCTTCTCCGTCGACCTCTCC
AAGGCCACTGTCCAGTCCAACCAGAACCCGTTCCAGGGAGGCCAGGGCGGAGCCCAGGTCGTCGGCGGCGGTACC
ACCTCTGGCGGTGGCGGAGGGCCGTCTCTGGGATTTGCCCACGGCGTCGTCATGGCCATCATCTTCCTCATCGGA
TATCCCGTCGGATCCATGCTGATGCCCCTGGTCGGCAGCTGGCTTCTACACGCCAGCTGGCAAATGCTCACCTTC
CTGGGCATGTGGGCGGGCTTCGGTATCGGATATGTCATCACCCAGAGAGCCAATGCTTTCTTCGTCGGTACCCAT
GTCCAATTTGGCGTCATCCTCTGCTGCCTCATGTGCCTGCAGCCCGTCTTCGGCTGGTTCCATCACAGATATTTC
GTCCAGCATCAGCAGCGCGGCATCGTCAGCTACGTACACATCTTTTACGGCCGTTCTCTCATGGCCCTGGGCGTC
ATCAACGGAGGATTGGGCCTGAAGCTCGCCGGCGGCTCCGGCTCCTTCGTCACGGCGTACAGCGTTATAGCTGCC
ATCGTTTTCGTGGCATACATCTTGTCTGCCGTGTACGCCACATTCAGGAAGAGGCGCCGGGTTAGCACCGAGACG
CCGAAGCTTCGACTGCAGTCCATCTGA
Gene >Hirsu2|2607
ATGAGGCTCAATCACCAGACAGCCATCGCGGCCGCGGCCGCCCTCGGTACGGCCACTCGTCAATGTCCTCTCCGT
CCTCCGTCCCGCTGACACTCGTCTCTGCCAGGCGCGACCGGGGCCTCTGGCGCATCGGCGCCCTTCTGCCCCGAA
TCCCAGGTCTGCTTCCGCTGGGGAATTCCGCAAAACGCCGCCACTTCGGCCCGCGGCACCGTCTACTTCCAGCTT
CGCGCGCCGACCGAATACCGGTGGGTCGGCCTCGGTATCGGATCCCAGATGCGCGGCGCCGACATGTTCGTCATG
TACGCTGCCGGCAACAACAACGTGACGCTCAGCACCAGGCAGGGCCAGGGGCACACCATGCCTCAGTACAGCGCG
AGGAACGACGTCCAGCTCATGGCCGGCTCCGGCATCAGCAACGGCCAGATGACGGCCAACGTTCGCTGCACCGGC
TGCGACAAGCTCGACCCATCGGGTTCGTCCGACTGGATAGCCGCTTGGCTCGAGGGTAGCCCAATGAACTCGGCC
AGCCCGTCGGAGCGCATCGCCATCCACGGCGGCTATGACGGCTTCTCCGTCGACCTCTCCAAGGCCACTGTCCAG
TCCAACCAGAACCCGTTCCAGGGAGGCCAGGGCGGAGCCCAGGTCGTCGGCGGCGGTACCACCTCTGGCGGTGGC
GGAGGGCCGTCTCTGGGATTTGCCCACGGCGTCGTCATGGCCATCATCTTCCTCATCGGATATCCCGTCGGATCC
ATGCTGATGCCCCTGGTCGGCAGCTGGCTTCTACACGCCAGCTGGCAAATGCTCACCTTCCTGGGCATGTGGGCG
GGCTTCGGTATCGGATATGTCATCACCCAGAGAGCCAATGCTGTGAGTGCCCGAGCGGCAGTTGTCGATGGTTTT
GGGTGACTGACTGGCACAGTTCTTCGTCGGTACCCATGTCCAATTTGGCGTCATCCTCTGCTGCCTCATGTGCCT
GCAGCCCGTCTTCGGCTGGTTCCATCACAGATATTTCGTCCAGCATCAGCAGCGCGGCATCGTCAGCTACGTACA
CATCTTTTACGGCCGTTCTCTCATGGCCCTGGGCGTCATCAACGGAGGATTGGGCCTGAAGCTCGCCGGCGGCTC
CGGCTCCTTCGTCACGGCGTACAGCGTTATAGCTGCCATCGTTTTCGTGGCATACATCTTGTCTGCCGTGTACGC
CACATTCAGGAAGAGGCGCCGGGTTAGCACCGAGACGCCGAAGCTTCGACTGCAGTCCATCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail