Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2603
Gene name
LocationContig_1629:3196..5041
Strand+
Gene length (bp)1845
Transcript length (bp)1845
Coding sequence length (bp)1845
Protein length (aa) 615

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18404 Glyco_transf_24 Glucosyltransferase 24 2.4E-149 289 556
PF06427 UDP-g_GGTase UDP-glucose:Glycoprotein Glucosyltransferase 1.9E-39 143 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 1 556 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 18 559 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 3 559 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 3 556 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 3 556 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09140|UGGG_SCHPO UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpt1 PE=1 SV=2 1 556 0.0E+00
sp|Q09332|UGGG_DROME UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster GN=Ugt PE=1 SV=2 18 559 0.0E+00
sp|Q9NYU2|UGGG1_HUMAN UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens GN=UGGT1 PE=1 SV=3 3 559 0.0E+00
sp|Q6P5E4|UGGG1_MOUSE UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus GN=Uggt1 PE=1 SV=4 3 556 0.0E+00
sp|Q9JLA3|UGGG1_RAT UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus GN=Uggt1 PE=1 SV=2 3 556 0.0E+00
sp|Q0WL80|UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana GN=UGGT PE=1 SV=1 3 561 0.0E+00
sp|Q9NYU1|UGGG2_HUMAN UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens GN=UGGT2 PE=1 SV=4 2 556 2.0E-176
sp|Q8T191|UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum GN=ggtA PE=1 SV=2 21 556 1.0E-156
sp|P22023|KRE5_YEAST Killer toxin-resistance protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE5 PE=1 SV=2 10 501 4.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0003980 UDP-glucose:glycoprotein glucosyltransferase activity Yes
GO:0035251 UDP-glucosyltransferase activity No
GO:0008194 UDP-glycosyltransferase activity No
GO:0016757 glycosyltransferase activity No
GO:0008150 biological_process No
GO:0046527 glucosyltransferase activity No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043413 macromolecule glycosylation No
GO:0008152 metabolic process No
GO:0070085 glycosylation No
GO:0016740 transferase activity No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0036211 protein modification process No
GO:0043170 macromolecule metabolic process No
GO:0016758 hexosyltransferase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.3831 0.2801 0.1093 0.2773 0.1056 0.0702 0.603 0.3201 0.3769 0.0149

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT24 2.8E-135 289 536

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5033
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6527
Ophiocordyceps australis map64 (Brazil) OphauB2|4275
Ophiocordyceps camponoti-floridani Ophcf2|01772
Ophiocordyceps camponoti-rufipedis Ophun1|4911
Ophiocordyceps kimflemingae Ophio5|4972
Ophiocordyceps subramaniannii Hirsu2|2603 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2603
MSHAAIEIGDAETASIHLAGLLDPVSEKGQRWAPILKVLSELDGVHIKLILNPREKIGELALKRFFRYVMDAEPS
FDQSGTVRALKASFRNLPSEALLTVGMDVPSAWLVAPKESVHDLDNIKLGSIKSNVDATYELEHILIEGHSREGL
GRPPRGAQLVLATEKEPMVTDTIVMSNLGFFQFKANPGFYNIQLKEGRTAEIYTIESIGSQGWAAVPGDKGTELA
LMDFQGTTLYPRLKRQPGMEQEDVLDQESAFSTAGLFSKSWKLAEGLLGGGKTKSLSAQEHAEINIFSVASGHLY
ERMLNIMILSVMRNTKHSVKFWFIEQFLSPSFREFIPYLAEEYGFEYEMVTYKWPHWLRQQKEKQREIWGYKILF
LDVLFPLSLDKVIFVDADQIVRTDMMDLVKLDLKGAPYGFTPMCDSRTEMEGFRFWKQGYWANYLRGRPYHISAL
YVVDLRRFRELAAGDRLRQQYHALSADPGSLSNLDQDLPNHMQFDIPIHSLPQEWLWCETWCSDESQAKARTIDL
CNNPQTKEPKLDRARRQVPEWTVYDAEIAELAKRRLHRGPGKKAENDAAPIGDNAATDARGAKQKESGPREINTK
GCNWDERAHCIDEL*
Coding >Hirsu2|2603
ATGAGCCATGCTGCCATTGAGATAGGAGATGCCGAAACGGCCAGCATTCACCTTGCGGGACTTCTGGACCCTGTC
AGCGAGAAGGGACAGAGATGGGCGCCCATTCTCAAAGTATTATCGGAGTTGGACGGGGTGCACATCAAGCTGATA
CTCAACCCGCGTGAGAAGATCGGCGAACTTGCATTAAAACGGTTCTTCAGATATGTTATGGATGCCGAGCCTTCG
TTTGATCAGAGCGGGACGGTCAGGGCGCTGAAAGCAAGCTTTAGAAATCTGCCCTCGGAGGCTCTTTTGACAGTG
GGCATGGATGTCCCATCTGCGTGGCTTGTCGCGCCTAAGGAGTCTGTCCATGATCTCGACAACATCAAGTTAGGC
TCCATCAAGTCCAATGTTGATGCGACTTACGAGCTCGAGCATATCCTCATTGAAGGCCACTCGCGGGAAGGCCTA
GGGCGGCCTCCCAGAGGTGCACAGTTGGTACTGGCTACCGAGAAGGAACCTATGGTTACGGACACCATCGTTATG
TCGAATCTTGGCTTCTTCCAGTTCAAGGCAAACCCTGGCTTCTACAATATTCAACTCAAGGAGGGACGTACAGCG
GAAATTTACACGATTGAGAGCATAGGGTCTCAAGGATGGGCGGCCGTTCCCGGCGACAAGGGTACTGAGTTAGCT
CTGATGGACTTCCAGGGAACGACATTGTATCCGCGCCTCAAGCGACAACCCGGCATGGAGCAGGAAGATGTTCTG
GACCAAGAAAGTGCTTTCTCGACTGCCGGCTTGTTTTCAAAGAGCTGGAAACTTGCTGAAGGACTACTTGGTGGA
GGAAAGACCAAGTCGCTTTCGGCGCAGGAGCACGCGGAAATTAACATATTTTCTGTGGCCAGCGGGCATCTATAT
GAGCGTATGCTCAACATCATGATTCTGTCGGTAATGCGAAACACAAAGCACAGCGTCAAATTCTGGTTCATCGAG
CAGTTCCTCTCGCCATCCTTCAGGGAGTTCATTCCGTACTTGGCAGAGGAGTACGGTTTCGAGTATGAGATGGTG
ACATACAAATGGCCGCACTGGCTGCGACAGCAGAAGGAGAAGCAACGCGAAATTTGGGGATACAAGATCTTGTTC
CTTGACGTGCTTTTCCCGCTGTCGCTCGACAAGGTTATCTTCGTGGACGCGGACCAAATCGTCCGGACAGATATG
ATGGATCTGGTCAAACTTGATTTAAAGGGCGCGCCCTACGGGTTCACGCCTATGTGTGACTCCCGGACTGAAATG
GAGGGATTTAGATTCTGGAAACAGGGGTACTGGGCCAACTACCTCCGAGGACGGCCATATCATATCTCGGCGCTC
TATGTGGTCGACCTGCGCCGCTTCCGAGAGCTTGCCGCCGGCGACCGGCTGCGGCAGCAGTACCACGCACTTAGC
GCCGACCCAGGCAGCCTGTCAAATCTGGATCAGGATCTTCCTAACCACATGCAATTCGACATACCCATCCACAGC
CTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGACGAGAGCCAGGCCAAGGCGCGCACCATTGACCTT
TGCAACAATCCTCAGACCAAGGAGCCCAAGCTGGACCGCGCCAGACGGCAGGTGCCCGAATGGACCGTCTACGAC
GCCGAGATTGCCGAGCTGGCCAAGAGACGCCTGCATAGGGGGCCAGGCAAGAAGGCAGAAAATGATGCCGCACCT
ATCGGCGACAATGCGGCGACAGATGCAAGAGGCGCCAAGCAGAAGGAATCTGGCCCGCGCGAGATCAATACCAAA
GGCTGCAACTGGGATGAGAGAGCGCACTGCATAGACGAGCTGTAA
Transcript >Hirsu2|2603
ATGAGCCATGCTGCCATTGAGATAGGAGATGCCGAAACGGCCAGCATTCACCTTGCGGGACTTCTGGACCCTGTC
AGCGAGAAGGGACAGAGATGGGCGCCCATTCTCAAAGTATTATCGGAGTTGGACGGGGTGCACATCAAGCTGATA
CTCAACCCGCGTGAGAAGATCGGCGAACTTGCATTAAAACGGTTCTTCAGATATGTTATGGATGCCGAGCCTTCG
TTTGATCAGAGCGGGACGGTCAGGGCGCTGAAAGCAAGCTTTAGAAATCTGCCCTCGGAGGCTCTTTTGACAGTG
GGCATGGATGTCCCATCTGCGTGGCTTGTCGCGCCTAAGGAGTCTGTCCATGATCTCGACAACATCAAGTTAGGC
TCCATCAAGTCCAATGTTGATGCGACTTACGAGCTCGAGCATATCCTCATTGAAGGCCACTCGCGGGAAGGCCTA
GGGCGGCCTCCCAGAGGTGCACAGTTGGTACTGGCTACCGAGAAGGAACCTATGGTTACGGACACCATCGTTATG
TCGAATCTTGGCTTCTTCCAGTTCAAGGCAAACCCTGGCTTCTACAATATTCAACTCAAGGAGGGACGTACAGCG
GAAATTTACACGATTGAGAGCATAGGGTCTCAAGGATGGGCGGCCGTTCCCGGCGACAAGGGTACTGAGTTAGCT
CTGATGGACTTCCAGGGAACGACATTGTATCCGCGCCTCAAGCGACAACCCGGCATGGAGCAGGAAGATGTTCTG
GACCAAGAAAGTGCTTTCTCGACTGCCGGCTTGTTTTCAAAGAGCTGGAAACTTGCTGAAGGACTACTTGGTGGA
GGAAAGACCAAGTCGCTTTCGGCGCAGGAGCACGCGGAAATTAACATATTTTCTGTGGCCAGCGGGCATCTATAT
GAGCGTATGCTCAACATCATGATTCTGTCGGTAATGCGAAACACAAAGCACAGCGTCAAATTCTGGTTCATCGAG
CAGTTCCTCTCGCCATCCTTCAGGGAGTTCATTCCGTACTTGGCAGAGGAGTACGGTTTCGAGTATGAGATGGTG
ACATACAAATGGCCGCACTGGCTGCGACAGCAGAAGGAGAAGCAACGCGAAATTTGGGGATACAAGATCTTGTTC
CTTGACGTGCTTTTCCCGCTGTCGCTCGACAAGGTTATCTTCGTGGACGCGGACCAAATCGTCCGGACAGATATG
ATGGATCTGGTCAAACTTGATTTAAAGGGCGCGCCCTACGGGTTCACGCCTATGTGTGACTCCCGGACTGAAATG
GAGGGATTTAGATTCTGGAAACAGGGGTACTGGGCCAACTACCTCCGAGGACGGCCATATCATATCTCGGCGCTC
TATGTGGTCGACCTGCGCCGCTTCCGAGAGCTTGCCGCCGGCGACCGGCTGCGGCAGCAGTACCACGCACTTAGC
GCCGACCCAGGCAGCCTGTCAAATCTGGATCAGGATCTTCCTAACCACATGCAATTCGACATACCCATCCACAGC
CTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGACGAGAGCCAGGCCAAGGCGCGCACCATTGACCTT
TGCAACAATCCTCAGACCAAGGAGCCCAAGCTGGACCGCGCCAGACGGCAGGTGCCCGAATGGACCGTCTACGAC
GCCGAGATTGCCGAGCTGGCCAAGAGACGCCTGCATAGGGGGCCAGGCAAGAAGGCAGAAAATGATGCCGCACCT
ATCGGCGACAATGCGGCGACAGATGCAAGAGGCGCCAAGCAGAAGGAATCTGGCCCGCGCGAGATCAATACCAAA
GGCTGCAACTGGGATGAGAGAGCGCACTGCATAGACGAGCTGTAA
Gene >Hirsu2|2603
ATGAGCCATGCTGCCATTGAGATAGGAGATGCCGAAACGGCCAGCATTCACCTTGCGGGACTTCTGGACCCTGTC
AGCGAGAAGGGACAGAGATGGGCGCCCATTCTCAAAGTATTATCGGAGTTGGACGGGGTGCACATCAAGCTGATA
CTCAACCCGCGTGAGAAGATCGGCGAACTTGCATTAAAACGGTTCTTCAGATATGTTATGGATGCCGAGCCTTCG
TTTGATCAGAGCGGGACGGTCAGGGCGCTGAAAGCAAGCTTTAGAAATCTGCCCTCGGAGGCTCTTTTGACAGTG
GGCATGGATGTCCCATCTGCGTGGCTTGTCGCGCCTAAGGAGTCTGTCCATGATCTCGACAACATCAAGTTAGGC
TCCATCAAGTCCAATGTTGATGCGACTTACGAGCTCGAGCATATCCTCATTGAAGGCCACTCGCGGGAAGGCCTA
GGGCGGCCTCCCAGAGGTGCACAGTTGGTACTGGCTACCGAGAAGGAACCTATGGTTACGGACACCATCGTTATG
TCGAATCTTGGCTTCTTCCAGTTCAAGGCAAACCCTGGCTTCTACAATATTCAACTCAAGGAGGGACGTACAGCG
GAAATTTACACGATTGAGAGCATAGGGTCTCAAGGATGGGCGGCCGTTCCCGGCGACAAGGGTACTGAGTTAGCT
CTGATGGACTTCCAGGGAACGACATTGTATCCGCGCCTCAAGCGACAACCCGGCATGGAGCAGGAAGATGTTCTG
GACCAAGAAAGTGCTTTCTCGACTGCCGGCTTGTTTTCAAAGAGCTGGAAACTTGCTGAAGGACTACTTGGTGGA
GGAAAGACCAAGTCGCTTTCGGCGCAGGAGCACGCGGAAATTAACATATTTTCTGTGGCCAGCGGGCATCTATAT
GAGCGTATGCTCAACATCATGATTCTGTCGGTAATGCGAAACACAAAGCACAGCGTCAAATTCTGGTTCATCGAG
CAGTTCCTCTCGCCATCCTTCAGGGAGTTCATTCCGTACTTGGCAGAGGAGTACGGTTTCGAGTATGAGATGGTG
ACATACAAATGGCCGCACTGGCTGCGACAGCAGAAGGAGAAGCAACGCGAAATTTGGGGATACAAGATCTTGTTC
CTTGACGTGCTTTTCCCGCTGTCGCTCGACAAGGTTATCTTCGTGGACGCGGACCAAATCGTCCGGACAGATATG
ATGGATCTGGTCAAACTTGATTTAAAGGGCGCGCCCTACGGGTTCACGCCTATGTGTGACTCCCGGACTGAAATG
GAGGGATTTAGATTCTGGAAACAGGGGTACTGGGCCAACTACCTCCGAGGACGGCCATATCATATCTCGGCGCTC
TATGTGGTCGACCTGCGCCGCTTCCGAGAGCTTGCCGCCGGCGACCGGCTGCGGCAGCAGTACCACGCACTTAGC
GCCGACCCAGGCAGCCTGTCAAATCTGGATCAGGATCTTCCTAACCACATGCAATTCGACATACCCATCCACAGC
CTGCCGCAGGAGTGGCTGTGGTGCGAGACGTGGTGCAGCGACGAGAGCCAGGCCAAGGCGCGCACCATTGACCTT
TGCAACAATCCTCAGACCAAGGAGCCCAAGCTGGACCGCGCCAGACGGCAGGTGCCCGAATGGACCGTCTACGAC
GCCGAGATTGCCGAGCTGGCCAAGAGACGCCTGCATAGGGGGCCAGGCAAGAAGGCAGAAAATGATGCCGCACCT
ATCGGCGACAATGCGGCGACAGATGCAAGAGGCGCCAAGCAGAAGGAATCTGGCCCGCGCGAGATCAATACCAAA
GGCTGCAACTGGGATGAGAGAGCGCACTGCATAGACGAGCTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail