Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|26
Gene name
LocationContig_10:73545..75469
Strand+
Gene length (bp)1924
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08659 KR KR domain 1.0E-54 191 360
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 1.1E-16 35 166
PF00106 adh_short short chain dehydrogenase 1.3E-10 193 344
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 3.5E-08 2 109
PF01370 Epimerase NAD dependent epimerase/dehydratase family 6.8E-06 193 325

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 559 2.0E-72
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1 543 1.0E-45
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1 543 1.0E-45
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 2 386 1.0E-39
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 2 369 2.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 559 2.0E-72
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1 543 1.0E-45
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1 543 1.0E-45
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 2 386 1.0E-39
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 2 369 2.0E-39
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1 364 3.0E-39
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 2 369 1.0E-38
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 2 368 1.0E-38
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 2 368 9.0E-38
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 7 361 4.0E-36
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 7 361 4.0E-36
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 7 361 4.0E-36
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 7 361 4.0E-36
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 7 361 4.0E-36
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 3 359 4.0E-34
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 3 372 6.0E-33
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 3 559 4.0E-31
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 3 351 1.0E-29
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 3 351 4.0E-29
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 4 533 8.0E-28
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 4 533 1.0E-26
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 6 533 2.0E-26
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 177 551 4.0E-26
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 165 369 5.0E-26
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 165 369 1.0E-25
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 4 538 8.0E-18
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 6 541 2.0E-17
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 184 366 2.0E-17
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 4 538 4.0E-17
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 6 538 6.0E-16
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 6 541 1.0E-15
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 6 541 2.0E-15
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 6 541 2.0E-15
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 6 541 2.0E-15
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 180 400 1.0E-14
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 180 400 1.0E-14
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 180 400 1.0E-14
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 6 392 3.0E-14
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 4 392 5.0E-14
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 191 374 5.0E-14
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 4 366 6.0E-14
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 6 563 7.0E-14
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 183 346 1.0E-13
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 181 401 2.0E-13
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 187 394 3.0E-13
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 6 366 6.0E-13
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 4 366 7.0E-13
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 6 403 1.0E-12
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 6 533 2.0E-12
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 187 353 3.0E-12
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 181 369 3.0E-12
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 181 369 4.0E-12
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 181 369 4.0E-12
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 6 356 4.0E-12
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 4 366 9.0E-12
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 191 359 9.0E-12
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 4 366 5.0E-11
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 4 541 7.0E-11
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 4 366 1.0E-10
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 4 399 2.0E-10
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 6 356 3.0E-10
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 205 407 4.0E-10
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 6 555 4.0E-10
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 6 366 4.0E-10
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 206 531 6.0E-10
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 4 366 8.0E-10
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 6 166 8.0E-10
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 176 349 1.0E-09
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 206 539 4.0E-09
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 6 366 5.0E-09
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 206 386 8.0E-09
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 206 386 8.0E-09
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 206 386 8.0E-09
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 6 539 3.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 149 547 8.0E-08
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 192 346 9.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 192 346 5.0E-07
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 192 343 1.0E-06
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 189 334 3.0E-06
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 137 343 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|26
MIGAEIYCTVGSREKIDYLMGNHGIPRAHIFHSMDSSFLGDVRRATDNRGVDVVLNSLSGDLLHASWECVAEFGT
MVEIGKRDFRRRAKLSMETFEANRTFIGLDVKRWVDLRQNEAIGVVKRCLGWMRSGSLDPTIAIAGVWKAEQVRD
AFRFMQSGQHIGKIVIRMPEEASSLASVSPRRSVSLRADRSYLLVGGLGGLGRAIATWLVEQGARQLIFLSRSAA
ARPELDGFLAELSSMGCRVQLVQGDARSIADVRRAVDSAAAPIAGVVNLAMDKSLDEMSFEDWTAAVEPKVQSTW
NLHHAISSDLDFFVLTSSVCGIMGRQGQANYSAAGSFLDAFVQYRHHTGLAASVIDIGVVGGLGCVMEAGEGFLY
GMQISTGVQIIGEQNLFEAMILAIHRSRGAPIESMPDGARRSPGQIVLGLYPPILRPKILSRFLMDARLAIIHNV
RNQKSRAAQGSLNESELDSFMSSIAAQPSILEEADKVATFIAAEVTSALAKMLMKDEGSIGVEHSPQQAGNDSLV
GLEMRTWIRQRLGVDVSVPSIVKRTSFMALGELIRLALVRTFAK*
Coding >Hirsu2|26
ATGATCGGCGCCGAGATCTACTGCACGGTCGGCAGCAGGGAAAAGATCGACTATCTCATGGGGAACCATGGCATT
CCGCGGGCGCACATCTTCCACTCGATGGATTCGTCCTTCCTCGGGGATGTCAGGCGCGCGACCGACAACAGGGGG
GTCGATGTCGTCCTCAACTCCCTGTCCGGCGATCTCCTCCACGCCTCCTGGGAGTGCGTTGCCGAGTTCGGGACC
ATGGTCGAGATCGGCAAACGGGATTTTCGACGACGCGCAAAGCTGTCCATGGAGACCTTCGAGGCGAACCGGACC
TTCATCGGCCTCGACGTGAAGCGATGGGTGGATCTCCGACAGAACGAGGCCATTGGTGTCGTGAAGCGCTGCCTC
GGATGGATGCGGTCCGGGTCGCTCGATCCCACCATTGCCATTGCCGGAGTGTGGAAGGCCGAGCAGGTAAGGGAT
GCCTTCAGGTTCATGCAGAGCGGGCAGCATATCGGTAAGATCGTCATCCGCATGCCGGAGGAGGCCTCATCTCTC
GCTTCCGTCAGTCCCAGACGCTCTGTGAGCCTGCGCGCCGACCGCTCTTACCTCCTCGTCGGGGGCTTGGGCGGC
CTCGGCAGGGCCATCGCCACTTGGCTGGTCGAGCAGGGCGCCCGCCAGTTGATTTTCCTGTCGCGATCTGCAGCG
GCAAGGCCGGAGCTCGACGGCTTTTTGGCTGAGCTCTCCTCGATGGGTTGCCGGGTCCAACTGGTGCAGGGCGAT
GCCAGAAGCATTGCCGACGTCAGGAGGGCCGTCGACTCTGCGGCCGCGCCGATCGCGGGAGTGGTCAACCTCGCC
ATGGACAAGTCTCTCGACGAGATGTCCTTCGAGGACTGGACCGCAGCCGTAGAGCCCAAGGTCCAGAGCACGTGG
AACCTGCACCATGCCATCTCCTCCGACCTCGACTTCTTCGTCCTGACTTCTTCGGTATGCGGCATTATGGGTCGC
CAGGGTCAGGCCAACTACTCGGCAGCCGGCTCGTTCCTGGATGCCTTTGTGCAGTATCGTCACCATACGGGCCTT
GCAGCATCCGTGATCGACATCGGGGTCGTAGGAGGCTTGGGCTGCGTCATGGAGGCGGGAGAGGGGTTTCTCTAC
GGTATGCAGATTTCAACTGGCGTGCAGATTATCGGGGAGCAGAACCTTTTCGAAGCCATGATATTGGCCATTCAC
AGGTCCCGGGGAGCGCCCATAGAATCGATGCCAGATGGAGCACGCAGGAGCCCGGGCCAAATCGTGTTGGGCCTG
TACCCACCAATCTTACGTCCCAAGATCCTGTCGCGATTCCTTATGGACGCCCGATTGGCCATCATTCACAACGTC
AGGAACCAGAAGTCAAGGGCCGCGCAAGGGTCCCTGAATGAGAGCGAGCTCGACTCCTTCATGTCTTCAATAGCG
GCCCAACCATCGATCCTGGAGGAGGCGGACAAGGTGGCGACTTTCATTGCAGCAGAAGTAACATCCGCCTTGGCC
AAGATGTTGATGAAAGACGAGGGCAGCATCGGGGTCGAGCATTCGCCCCAGCAGGCCGGTAATGACTCGCTCGTC
GGGCTGGAAATGCGCACTTGGATCCGGCAGAGACTGGGTGTTGACGTGTCTGTGCCGTCCATCGTTAAGCGTACC
TCGTTTATGGCTTTGGGGGAGCTGATCCGGCTAGCCCTGGTCCGTACGTTTGCCAAATAA
Transcript >Hirsu2|26
ATGATCGGCGCCGAGATCTACTGCACGGTCGGCAGCAGGGAAAAGATCGACTATCTCATGGGGAACCATGGCATT
CCGCGGGCGCACATCTTCCACTCGATGGATTCGTCCTTCCTCGGGGATGTCAGGCGCGCGACCGACAACAGGGGG
GTCGATGTCGTCCTCAACTCCCTGTCCGGCGATCTCCTCCACGCCTCCTGGGAGTGCGTTGCCGAGTTCGGGACC
ATGGTCGAGATCGGCAAACGGGATTTTCGACGACGCGCAAAGCTGTCCATGGAGACCTTCGAGGCGAACCGGACC
TTCATCGGCCTCGACGTGAAGCGATGGGTGGATCTCCGACAGAACGAGGCCATTGGTGTCGTGAAGCGCTGCCTC
GGATGGATGCGGTCCGGGTCGCTCGATCCCACCATTGCCATTGCCGGAGTGTGGAAGGCCGAGCAGGTAAGGGAT
GCCTTCAGGTTCATGCAGAGCGGGCAGCATATCGGTAAGATCGTCATCCGCATGCCGGAGGAGGCCTCATCTCTC
GCTTCCGTCAGTCCCAGACGCTCTGTGAGCCTGCGCGCCGACCGCTCTTACCTCCTCGTCGGGGGCTTGGGCGGC
CTCGGCAGGGCCATCGCCACTTGGCTGGTCGAGCAGGGCGCCCGCCAGTTGATTTTCCTGTCGCGATCTGCAGCG
GCAAGGCCGGAGCTCGACGGCTTTTTGGCTGAGCTCTCCTCGATGGGTTGCCGGGTCCAACTGGTGCAGGGCGAT
GCCAGAAGCATTGCCGACGTCAGGAGGGCCGTCGACTCTGCGGCCGCGCCGATCGCGGGAGTGGTCAACCTCGCC
ATGGACAAGTCTCTCGACGAGATGTCCTTCGAGGACTGGACCGCAGCCGTAGAGCCCAAGGTCCAGAGCACGTGG
AACCTGCACCATGCCATCTCCTCCGACCTCGACTTCTTCGTCCTGACTTCTTCGGTATGCGGCATTATGGGTCGC
CAGGGTCAGGCCAACTACTCGGCAGCCGGCTCGTTCCTGGATGCCTTTGTGCAGTATCGTCACCATACGGGCCTT
GCAGCATCCGTGATCGACATCGGGGTCGTAGGAGGCTTGGGCTGCGTCATGGAGGCGGGAGAGGGGTTTCTCTAC
GGTATGCAGATTTCAACTGGCGTGCAGATTATCGGGGAGCAGAACCTTTTCGAAGCCATGATATTGGCCATTCAC
AGGTCCCGGGGAGCGCCCATAGAATCGATGCCAGATGGAGCACGCAGGAGCCCGGGCCAAATCGTGTTGGGCCTG
TACCCACCAATCTTACGTCCCAAGATCCTGTCGCGATTCCTTATGGACGCCCGATTGGCCATCATTCACAACGTC
AGGAACCAGAAGTCAAGGGCCGCGCAAGGGTCCCTGAATGAGAGCGAGCTCGACTCCTTCATGTCTTCAATAGCG
GCCCAACCATCGATCCTGGAGGAGGCGGACAAGGTGGCGACTTTCATTGCAGCAGAAGTAACATCCGCCTTGGCC
AAGATGTTGATGAAAGACGAGGGCAGCATCGGGGTCGAGCATTCGCCCCAGCAGGCCGGTAATGACTCGCTCGTC
GGGCTGGAAATGCGCACTTGGATCCGGCAGAGACTGGGTGTTGACGTGTCTGTGCCGTCCATCGTTAAGCGTACC
TCGTTTATGGCTTTGGGGGAGCTGATCCGGCTAGCCCTGGTCCGTACGTTTGCCAAATAA
Gene >Hirsu2|26
ATGATCGGCGCCGAGGTAGTCAAGCCCCGTCTGGCCGTATGGCCGTATGCGAGGCCGAGGCGAAGTTGACCTGAC
GTCCACGGCAGATCTACTGCACGGTCGGCAGCAGGGAAAAGATCGACTATCTCATGGGGAACCATGGCATTCCGC
GGGCGCACATCTTCCACTCGATGGATTCGTCCTTCCTCGGGGATGTCAGGCGCGCGACCGACAACAGGGGGGTCG
ATGTCGTCCTCAACTCCCTGTCCGGCGATCTCCTCCACGCCTCCTGGGAGTGCGTTGCCGAGTTCGGGACCATGG
TCGAGATCGGCAAACGGGATTTTCGACGACGCGCAAAGCTGTCCATGGAGACCTTCGAGGCGAACCGGACCTTCA
TCGGCCTCGACGTGAAGCGATGGGTGGATCTCCGACAGAACGAGGCCATTGGGTGAGCGCCGTCCCACCCCAACA
TACCGTCGTACCTGTGCCCAGCCCCTGACTCTGCAACTCAAGTGTCGTGAAGCGCTGCCTCGGATGGATGCGGTC
CGGGTCGCTCGATCCCACCATTGCCATTGCCGGAGTGTGGAAGGCCGAGCAGGTAAGGGATGCCTTCAGGTTCAT
GCAGAGCGGGCAGCATATCGGTAAGATCGTCATCCGCATGCCGGAGGAGGCCTCATCTCTCGCTTCCGTCAGTCC
CAGACGCTCTGTGAGCCTGCGCGCCGACCGCTCTTACCTCCTCGTCGGGGGCTTGGGCGGCCTCGGCAGGGCCAT
CGCCACTTGGCTGGTCGAGCAGGGCGCCCGCCAGTTGATTTTCCTGTCGCGATCTGCAGCGGCAAGGCCGGAGCT
CGACGGCTTTTTGGCTGAGCTCTCCTCGATGGGTTGCCGGGTCCAACTGGTGCAGGGCGATGCCAGAAGCATTGC
CGACGTCAGGAGGGCCGTCGACTCTGCGGCCGCGCCGATCGCGGGAGTGGTCAACCTCGCCATGGTCTTGCGGGC
TCGCATACCCCATTCCCCTCTTCTTCTTCCGCCCATTTTCGAGGGCTGACATGACGCGCGCGTGCAGGACAAGTC
TCTCGACGAGATGTCCTTCGAGGACTGGACCGCAGCCGTAGAGCCCAAGGTCCAGAGCACGTGGAACCTGCACCA
TGCCATCTCCTCCGACCTCGACTTCTTCGTCCTGACTTCTTCGGTATGCGGCATTATGGGTCGCCAGGGTCAGGC
CAACTACTCGGCAGCCGGCTCGTTCCTGGATGCCTTTGTGCAGTATCGTCACCATACGGGCCTTGCAGCATCCGT
GATCGACATCGGGGTCGTAGGAGGCTTGGGCTGCGTCATGGAGGCGGGAGAGGGGTTTCTCTACGGTATGCAGAT
TTCAACTGGCGTGCAGATTATCGGGGAGCAGAACCTTTTCGAAGCCATGATATTGGCCATTCACAGGTCCCGGGG
AGCGCCCATAGAATCGATGCCAGATGGAGCACGCAGGAGCCCGGGCCAAATCGTGTTGGGCCTGTACCCACCAAT
CTTACGTCCCAAGATCCTGTCGCGATTCCTTATGGACGCCCGATTGGCCATCATTCACAACGTCAGGAACCAGAA
GTCAAGGGCCGCGCAAGGGTCCCTGAATGAGAGCGAGCTCGACTCCTTCATGTCTTCAATAGCGGCCCAACCATC
GATCCTGGAGGAGGCGGACAAGGTGGCGACTTTCATTGCAGCAGAAGTAACATCCGCCTTGGCCAAGATGTTGAT
GAAAGACGAGGGCAGCATCGGGGTCGAGCATTCGCCCCAGCAGGCCGGTAATGACTCGCTCGTCGGGCTGGAAAT
GCGCACTTGGATCCGGCAGAGACTGGGTGTTGACGTGTCTGTGCCGTCCATCGTTAAGCGTACCTCGTTTATGGC
TTTGGGGGAGCTGATCCGGCTAGCCCTGGTCCGTACGTTTGCCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail