Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2599
Gene name
LocationContig_1627:2524..4216
Strand-
Gene length (bp)1692
Transcript length (bp)1476
Coding sequence length (bp)1476
Protein length (aa) 492

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07647 SAM_2 SAM domain (Sterile alpha motif) 3.2E-16 69 129
PF00536 SAM_1 SAM domain (Sterile alpha motif) 3.5E-15 68 128
PF00788 RA Ras association (RalGDS/AF-6) domain 6.6E-12 387 460

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25344|STE50_YEAST Protein STE50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE50 PE=1 SV=1 386 458 8.0E-15
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 66 130 4.0E-07
sp|B3LXF2|DGKH_DROAN Diacylglycerol kinase eta OS=Drosophila ananassae GN=GF18176 PE=3 SV=2 69 129 4.0E-07
sp|B4PRE2|DGKH_DROYA Diacylglycerol kinase eta OS=Drosophila yakuba GN=GE24946 PE=3 SV=2 67 129 6.0E-07
sp|B4K6T8|DGKH_DROMO Diacylglycerol kinase eta OS=Drosophila mojavensis GN=GI24133 PE=3 SV=1 69 129 6.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25344|STE50_YEAST Protein STE50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE50 PE=1 SV=1 386 458 8.0E-15
sp|O74653|POB1_SCHPO Protein pob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pob1 PE=1 SV=1 66 130 4.0E-07
sp|B3LXF2|DGKH_DROAN Diacylglycerol kinase eta OS=Drosophila ananassae GN=GF18176 PE=3 SV=2 69 129 4.0E-07
sp|B4PRE2|DGKH_DROYA Diacylglycerol kinase eta OS=Drosophila yakuba GN=GE24946 PE=3 SV=2 67 129 6.0E-07
sp|B4K6T8|DGKH_DROMO Diacylglycerol kinase eta OS=Drosophila mojavensis GN=GI24133 PE=3 SV=1 69 129 6.0E-07
sp|B4I4Y1|DGKH_DROSE Diacylglycerol kinase eta OS=Drosophila sechellia GN=GM10981 PE=3 SV=2 69 129 7.0E-07
sp|A8JQ65|DGKH_DROME Diacylglycerol kinase eta OS=Drosophila melanogaster GN=CG34384 PE=2 SV=1 69 129 7.0E-07
sp|B3NYS4|DGKH_DROER Diacylglycerol kinase eta OS=Drosophila erecta GN=GG14241 PE=3 SV=2 69 129 7.0E-07
sp|B4JHJ7|DGKH_DROGR Diacylglycerol kinase eta OS=Drosophila grimshawi GN=GH18973 PE=3 SV=1 69 129 7.0E-07
sp|B4R0A5|DGKH_DROSI Diacylglycerol kinase eta OS=Drosophila simulans GN=GD19954 PE=3 SV=2 69 129 8.0E-07
sp|P36622|STE4_SCHPO Sexual differentiation protein ste4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ste4 PE=2 SV=1 389 458 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0007165 signal transduction Yes
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0050794 regulation of cellular process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5554 0.2957 0.0583 0.1567 0.0957 0.0019 0.1489 0.3336 0.2966 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2147
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2118
Ophiocordyceps australis map64 (Brazil) OphauB2|1911
Ophiocordyceps camponoti-floridani Ophcf2|01724
Ophiocordyceps camponoti-rufipedis Ophun1|5739
Ophiocordyceps kimflemingae Ophio5|7944
Ophiocordyceps subramaniannii Hirsu2|2599 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2599
MMSFDGGTAYAESDADDEYERSIGDRSPIGDSEASPIGSEPSTSAEHTPTTYAHRSTADRLPETIITEWTAEECA
DFISTIGLPQYADRFVENEIVGEALVALQHDDLKSMGIASVGHRLTILKSVYDVKKAQDVPVESDHYFPLSADAE
AQYATATLKDIRLLVEQLRLRDERMDLLEQDLRRTTEDFRRLREDMLPALRLAKDAQQPLPNLSGGSQAYTYEPT
LSPPAPTPPPPGQSSVPGVVRSYSQRKILIGATSKGTSPTQPTHERTIAEQTLDPASAAERAVLSSSHLSAMNGS
AQNASSSSYPSPNIPSPTSPQTHMSGTTLASRSYRSDTSAPSNRAALGDNDHANYGSRDKAPGGLPPRRRETPVP
DTPNTSNASVEIFKSFRVSMDDPCHKVLPAALKKYQINAPWDQYALYIVYGDQERCLGMDEKPLILFKQLDKEGK
KPMFMLRKTNNAQVDGDPGSAGMGGAARGASTGYDPPGGII*
Coding >Hirsu2|2599
ATGATGAGCTTCGACGGCGGCACGGCCTACGCCGAGTCAGACGCCGACGACGAGTACGAGCGGAGTATCGGCGAC
AGGTCCCCCATCGGCGACTCGGAGGCGTCCCCCATCGGCTCGGAGCCCTCGACGTCGGCCGAGCACACGCCCACG
ACGTACGCCCACCGCAGCACCGCCGATCGACTGCCTGAGACCATCATCACCGAATGGACCGCCGAAGAGTGTGCC
GACTTCATCAGCACCATCGGCCTCCCCCAGTATGCCGATCGATTTGTTGAAAACGAAATCGTGGGCGAGGCCCTC
GTTGCGCTCCAGCACGACGACCTCAAGAGCATGGGCATCGCAAGCGTCGGCCACCGGCTCACCATCCTCAAGAGC
GTCTACGACGTCAAGAAGGCCCAGGACGTGCCCGTCGAGAGCGACCATTACTTCCCGCTGTCCGCCGACGCCGAA
GCGCAGTACGCCACGGCCACGCTCAAGGACATCAGGCTCCTGGTCGAGCAGCTGCGCCTACGAGATGAGCGGATG
GATCTGCTGGAGCAGGATCTGCGGCGGACAACCGAGGACTTCCGCCGGCTCAGAGAGGATATGCTCCCCGCGCTG
CGCCTGGCCAAGGACGCGCAACAGCCGCTGCCCAACCTGAGTGGCGGCTCCCAAGCCTACACCTACGAGCCGACC
CTCTCGCCGCCCGCCCCCACGCCGCCGCCCCCCGGGCAGAGCTCCGTCCCCGGCGTCGTGCGCTCCTACTCGCAA
AGAAAGATACTGATCGGGGCCACGTCCAAGGGGACGTCCCCGACGCAGCCGACGCACGAGAGGACGATAGCGGAG
CAGACGCTGGACCCGGCCAGCGCCGCCGAGCGCGCCGTCTTGTCGTCATCACACCTTTCCGCCATGAACGGCTCG
GCCCAGAACGCGTCGTCATCCTCGTACCCCTCACCGAACATACCCTCTCCGACGTCGCCGCAGACGCACATGAGC
GGCACGACCCTGGCCTCTCGGTCGTACCGCAGCGACACGTCGGCGCCCTCGAACCGCGCGGCGCTGGGCGACAAC
GACCACGCAAACTACGGCTCCCGCGACAAGGCGCCCGGGGGCCTGCCTCCGCGCCGGCGCGAGACGCCGGTGCCC
GACACGCCTAACACCAGCAATGCGTCGGTCGAGATCTTCAAGTCCTTCCGCGTCAGCATGGACGACCCGTGCCAC
AAGGTGCTACCGGCCGCGCTCAAAAAGTACCAGATCAACGCGCCGTGGGACCAGTACGCGCTGTACATCGTCTAC
GGCGACCAGGAACGCTGCCTGGGCATGGACGAGAAGCCTTTGATCCTGTTTAAGCAACTAGACAAGGAGGGCAAG
AAGCCAATGTTCATGCTGCGCAAGACGAACAACGCGCAGGTCGACGGCGACCCGGGGAGCGCGGGCATGGGCGGC
GCGGCGAGAGGCGCATCGACAGGCTACGACCCGCCCGGAGGCATCATATGA
Transcript >Hirsu2|2599
ATGATGAGCTTCGACGGCGGCACGGCCTACGCCGAGTCAGACGCCGACGACGAGTACGAGCGGAGTATCGGCGAC
AGGTCCCCCATCGGCGACTCGGAGGCGTCCCCCATCGGCTCGGAGCCCTCGACGTCGGCCGAGCACACGCCCACG
ACGTACGCCCACCGCAGCACCGCCGATCGACTGCCTGAGACCATCATCACCGAATGGACCGCCGAAGAGTGTGCC
GACTTCATCAGCACCATCGGCCTCCCCCAGTATGCCGATCGATTTGTTGAAAACGAAATCGTGGGCGAGGCCCTC
GTTGCGCTCCAGCACGACGACCTCAAGAGCATGGGCATCGCAAGCGTCGGCCACCGGCTCACCATCCTCAAGAGC
GTCTACGACGTCAAGAAGGCCCAGGACGTGCCCGTCGAGAGCGACCATTACTTCCCGCTGTCCGCCGACGCCGAA
GCGCAGTACGCCACGGCCACGCTCAAGGACATCAGGCTCCTGGTCGAGCAGCTGCGCCTACGAGATGAGCGGATG
GATCTGCTGGAGCAGGATCTGCGGCGGACAACCGAGGACTTCCGCCGGCTCAGAGAGGATATGCTCCCCGCGCTG
CGCCTGGCCAAGGACGCGCAACAGCCGCTGCCCAACCTGAGTGGCGGCTCCCAAGCCTACACCTACGAGCCGACC
CTCTCGCCGCCCGCCCCCACGCCGCCGCCCCCCGGGCAGAGCTCCGTCCCCGGCGTCGTGCGCTCCTACTCGCAA
AGAAAGATACTGATCGGGGCCACGTCCAAGGGGACGTCCCCGACGCAGCCGACGCACGAGAGGACGATAGCGGAG
CAGACGCTGGACCCGGCCAGCGCCGCCGAGCGCGCCGTCTTGTCGTCATCACACCTTTCCGCCATGAACGGCTCG
GCCCAGAACGCGTCGTCATCCTCGTACCCCTCACCGAACATACCCTCTCCGACGTCGCCGCAGACGCACATGAGC
GGCACGACCCTGGCCTCTCGGTCGTACCGCAGCGACACGTCGGCGCCCTCGAACCGCGCGGCGCTGGGCGACAAC
GACCACGCAAACTACGGCTCCCGCGACAAGGCGCCCGGGGGCCTGCCTCCGCGCCGGCGCGAGACGCCGGTGCCC
GACACGCCTAACACCAGCAATGCGTCGGTCGAGATCTTCAAGTCCTTCCGCGTCAGCATGGACGACCCGTGCCAC
AAGGTGCTACCGGCCGCGCTCAAAAAGTACCAGATCAACGCGCCGTGGGACCAGTACGCGCTGTACATCGTCTAC
GGCGACCAGGAACGCTGCCTGGGCATGGACGAGAAGCCTTTGATCCTGTTTAAGCAACTAGACAAGGAGGGCAAG
AAGCCAATGTTCATGCTGCGCAAGACGAACAACGCGCAGGTCGACGGCGACCCGGGGAGCGCGGGCATGGGCGGC
GCGGCGAGAGGCGCATCGACAGGCTACGACCCGCCCGGAGGCATCATATGA
Gene >Hirsu2|2599
ATGATGAGCTTCGACGGCGGCACGGCCTACGCCGAGTCAGACGCCGACGACGAGTACGAGCGGAGTATCGGCGAC
AGGTCCCCCATCGGCGACTCGGAGGCGTCCCCCATCGGCTCGGAGCCCTCGACGTCGGCCGAGCACACGCCCACG
ACGTACGCCCACCGCAGCACCGCCGATCGACTGCCTGAGACCATCATCACCGAATGGACCGCCGAAGAGTGTGCC
GACTTCATCAGCACCATCGGCCTCCCCCAGTATGCCGATCGATTTGTTGGTGCGTCTGCTCCCCGCCGCCGCGAA
ACTCCCACATGAGCACACCCCCGCCGAGCCGGTCGGTGCATGTCAAGACTGATCGGCGTCTGCTTCTGGCCATAG
AAAACGAAATCGTGGGCGAGGCCCTCGTTGCGCTCCAGCACGACGACCTCAAGAGCATGGGCATCGCAAGCGTCG
GCCACCGGCTCACCATCCTCAAGAGCGTCTACGACGTCAAGAAGGCCCAGGACGTGCCCGTCGAGAGCGACCATT
ACTTCCCGCTGTGTAAGTGCCCACAACCCACCCCCCCTCTCTTTCTTGACCGAGCCACTCGTCTTCCCCTTCTTC
TCCCTCTTCTCCCAGACCAATGGCCGGCTGACCGAGATGCCGCCCTCCACAGCCGCCGACGCCGAAGCGCAGTAC
GCCACGGCCACGCTCAAGGACATCAGGCTCCTGGTCGAGCAGCTGCGCCTACGAGATGAGCGGATGGATCTGCTG
GAGCAGGATCTGCGGCGGACAACCGAGGACTTCCGCCGGCTCAGAGAGGATATGCTCCCCGCGCTGCGCCTGGCC
AAGGACGCGCAACAGCCGCTGCCCAACCTGAGTGGCGGCTCCCAAGCCTACACCTACGAGCCGACCCTCTCGCCG
CCCGCCCCCACGCCGCCGCCCCCCGGGCAGAGCTCCGTCCCCGGCGTCGTGCGCTCCTACTCGCAAAGAAAGATA
CTGATCGGGGCCACGTCCAAGGGGACGTCCCCGACGCAGCCGACGCACGAGAGGACGATAGCGGAGCAGACGCTG
GACCCGGCCAGCGCCGCCGAGCGCGCCGTCTTGTCGTCATCACACCTTTCCGCCATGAACGGCTCGGCCCAGAAC
GCGTCGTCATCCTCGTACCCCTCACCGAACATACCCTCTCCGACGTCGCCGCAGACGCACATGAGCGGCACGACC
CTGGCCTCTCGGTCGTACCGCAGCGACACGTCGGCGCCCTCGAACCGCGCGGCGCTGGGCGACAACGACCACGCA
AACTACGGCTCCCGCGACAAGGCGCCCGGGGGCCTGCCTCCGCGCCGGCGCGAGACGCCGGTGCCCGACACGCCT
AACACCAGCAATGCGTCGGTCGAGATCTTCAAGTCCTTCCGCGTCAGCATGGACGACCCGTGCCACAAGGTGCTA
CCGGCCGCGCTCAAAAAGTACCAGATCAACGCGCCGTGGGACCAGTACGCGCTGTACATCGTCTACGGCGACCAG
GAACGCTGCCTGGGCATGGACGAGAAGCCTTTGATCCTGTTTAAGCAACTAGACAAGGAGGGCAAGAAGCCAATG
TTCATGCTGCGCAAGACGAACAACGCGCAGGTCGACGGCGACCCGGGGAGCGCGGGCATGGGCGGCGCGGCGAGA
GGCGCATCGACAGGCTACGACCCGCCCGGAGGCATCATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail