Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2596
Gene name
LocationContig_1626:1040..1957
Strand-
Gene length (bp)917
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04191 PEMT Phospholipid methyltransferase 1.6E-31 98 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P05375|PEM2_YEAST Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPI3 PE=1 SV=1 9 202 6.0E-67
sp|O74827|CHO1_SCHPO Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cho1 PE=3 SV=1 18 203 1.0E-61
sp|Q61907|PEMT_MOUSE Phosphatidylethanolamine N-methyltransferase OS=Mus musculus GN=Pemt PE=1 SV=4 13 207 2.0E-49
sp|Q7YRH6|PEMT_BOVIN Phosphatidylethanolamine N-methyltransferase OS=Bos taurus GN=PEMT PE=2 SV=1 13 201 9.0E-49
sp|Q54SD5|PEM2_DICDI Putative phosphatidylethanolamine N-methyltransferase OS=Dictyostelium discoideum GN=pem2 PE=3 SV=1 10 196 6.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P05375|PEM2_YEAST Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPI3 PE=1 SV=1 9 202 6.0E-67
sp|O74827|CHO1_SCHPO Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cho1 PE=3 SV=1 18 203 1.0E-61
sp|Q61907|PEMT_MOUSE Phosphatidylethanolamine N-methyltransferase OS=Mus musculus GN=Pemt PE=1 SV=4 13 207 2.0E-49
sp|Q7YRH6|PEMT_BOVIN Phosphatidylethanolamine N-methyltransferase OS=Bos taurus GN=PEMT PE=2 SV=1 13 201 9.0E-49
sp|Q54SD5|PEM2_DICDI Putative phosphatidylethanolamine N-methyltransferase OS=Dictyostelium discoideum GN=pem2 PE=3 SV=1 10 196 6.0E-48
sp|Q9UBM1|PEMT_HUMAN Phosphatidylethanolamine N-methyltransferase OS=Homo sapiens GN=PEMT PE=1 SV=4 13 198 5.0E-41
sp|Q08388|PEMT_RAT Phosphatidylethanolamine N-methyltransferase OS=Rattus norvegicus GN=Pemt PE=1 SV=2 13 207 5.0E-39
sp|Q54H80|PEMTL_DICDI PEMT/PEM2 methyltransferase family protein OS=Dictyostelium discoideum GN=DDB_G0289645 PE=3 SV=1 19 212 2.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 59 78 19
3 98 120 22
4 140 162 22
5 167 184 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2596
MASPAAAGDLARYVDFDKQSLLVSACAIGFNPLFWNIVARQEYHNKLLTRLFGGRSRTACYALAVTIFSLGIVRD
LLYKRAIQEQPSHALLQTAYARAAAWALLAGGNTLVVSSTWALGITGTFLGDYFGILMDRMVTGFPFNVCGAPMY
WGSTMSFLGTALLFGKPAGLLLTGWVLVVYVLALRYEDPFTAGIYAKRDRERAAARSGKKLE*
Coding >Hirsu2|2596
ATGGCCTCCCCCGCCGCCGCCGGCGACCTCGCCCGCTACGTCGACTTCGACAAGCAGAGCCTGCTGGTGTCCGCG
TGCGCCATCGGCTTCAACCCGCTGTTCTGGAACATCGTTGCGCGCCAAGAGTACCATAACAAGCTGCTGACGAGG
CTCTTCGGCGGGCGGTCCCGCACGGCCTGCTACGCCCTGGCCGTCACCATCTTCTCGCTCGGCATCGTGCGCGAC
CTGCTGTACAAGCGGGCGATCCAGGAGCAGCCGTCGCACGCGCTGCTGCAGACGGCCTACGCGCGGGCGGCCGCG
TGGGCGCTGCTGGCCGGCGGCAACACCCTGGTCGTCAGCTCGACCTGGGCGCTCGGCATCACCGGCACCTTCCTG
GGCGACTACTTCGGCATCCTCATGGACCGCATGGTCACCGGCTTCCCCTTCAACGTCTGCGGCGCCCCCATGTAC
TGGGGCTCGACCATGAGCTTCCTTGGCACTGCCCTGCTCTTCGGCAAGCCCGCCGGCCTGCTGCTGACCGGCTGG
GTCCTGGTCGTCTACGTCCTGGCCCTGCGCTACGAGGACCCCTTCACGGCCGGCATCTACGCCAAGCGCGACCGC
GAGAGGGCCGCCGCCCGCTCCGGCAAGAAGCTGGAGTAG
Transcript >Hirsu2|2596
ATGGCCTCCCCCGCCGCCGCCGGCGACCTCGCCCGCTACGTCGACTTCGACAAGCAGAGCCTGCTGGTGTCCGCG
TGCGCCATCGGCTTCAACCCGCTGTTCTGGAACATCGTTGCGCGCCAAGAGTACCATAACAAGCTGCTGACGAGG
CTCTTCGGCGGGCGGTCCCGCACGGCCTGCTACGCCCTGGCCGTCACCATCTTCTCGCTCGGCATCGTGCGCGAC
CTGCTGTACAAGCGGGCGATCCAGGAGCAGCCGTCGCACGCGCTGCTGCAGACGGCCTACGCGCGGGCGGCCGCG
TGGGCGCTGCTGGCCGGCGGCAACACCCTGGTCGTCAGCTCGACCTGGGCGCTCGGCATCACCGGCACCTTCCTG
GGCGACTACTTCGGCATCCTCATGGACCGCATGGTCACCGGCTTCCCCTTCAACGTCTGCGGCGCCCCCATGTAC
TGGGGCTCGACCATGAGCTTCCTTGGCACTGCCCTGCTCTTCGGCAAGCCCGCCGGCCTGCTGCTGACCGGCTGG
GTCCTGGTCGTCTACGTCCTGGCCCTGCGCTACGAGGACCCCTTCACGGCCGGCATCTACGCCAAGCGCGACCGC
GAGAGGGCCGCCGCCCGCTCCGGCAAGAAGCTGGAGTAG
Gene >Hirsu2|2596
ATGGCCTCCCCCGCCGCCGCCGGCGACCTCGCCCGCTACGTCGACTTCGACAAGCAGAGCCTGCTGGGTGCGTCC
AGGCCGGCCGTGACGTCGCGCGATGGCGGGATGCTCTCTGTCTGACAAGCCTGGCCCGACGTGTACAGTGTCCGC
GTGCGCCATCGGCTTCAACCCGCTGTTCTGGAAGTATGTTCTCGTCCTCGGCCCCCTAGATGAGAGAGTGGGAGG
TGGGAGAGATGCAGGGCACCCGCTGAATGCGCACGCAAAAACGCCGGTCCGAATAGCATCGTTGCGCGCCAAGGT
TCGAGCCTCTTTCCCTTCGCCCTTCCCTCACGGCCAAAACGGTCGCCGAGGGGGGGGAGGCCGGATCGCAGGCAC
GGGGACTGACGGGGATGCGGCGCGCAGAGTACCATAACAAGCTGCTGACGAGGCTCTTCGGCGGGCGGTCCCGCA
CGGCCTGCTACGCCCTGGCCGTCACCATCTTCTCGCTCGGCATCGTGCGCGACCTGCTGTACAAGCGGGCGATCC
AGGAGCAGCCGTCGCACGCGCTGCTGCAGACGGCCTACGCGCGGGCGGCCGCGTGGGCGCTGCTGGCCGGCGGCA
ACACCCTGGTCGTCAGCTCGACCTGGGCGCTCGGCATCACCGGCACCTTCCTGGGCGACTACTTCGGCATCCTCA
TGGACCGCATGGTCACCGGCTTCCCCTTCAACGTCTGCGGCGCCCCCATGTACTGGGGCTCGACCATGAGCTTCC
TTGGCACTGCCCTGCTCTTCGGCAAGCCCGCCGGCCTGCTGCTGACCGGCTGGGTCCTGGTCGTCTACGTCCTGG
CCCTGCGCTACGAGGACCCCTTCACGGCCGGCATCTACGCCAAGCGCGACCGCGAGAGGGCCGCCGCCCGCTCCG
GCAAGAAGCTGGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail