Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2593
Gene name
LocationContig_1624:4573..5179
Strand-
Gene length (bp)606
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16399 Aquarius_N Intron-binding protein aquarius N-terminus 1.2E-38 38 145

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60306|AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 35 146 1.0E-09
sp|Q8CFQ3|AQR_MOUSE Intron-binding protein aquarius OS=Mus musculus GN=Aqr PE=1 SV=2 35 146 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2593
MPNAKRLKSSGFTRPRQAKETGSQTEVGRPTPAEVEEKEHQFVQLARKHWLKPGKRTTRPKVKNEVLKQSIWDVL
DKEGFQYKSLLLLESLQALESYLWPSYSEQSSNYHVLLMALIANAKRREHLDTWNIFEDRPDDFSSMFRQLN*
Coding >Hirsu2|2593
ATGCCTAATGCGAAGCGGCTCAAGAGCAGCGGCTTTACCAGGCCCCGGCAGGCCAAGGAAACTGGCTCTCAGACC
GAAGTTGGCCGGCCGACTCCCGCCGAGGTTGAAGAAAAAGAGCATCAGTTTGTCCAACTGGCTCGGAAGCATTGG
CTCAAGCCTGGGAAGAGAACGACCAGGCCCAAGGTCAAGAACGAGGTCCTCAAACAGAGTATATGGGACGTGCTC
GACAAGGAGGGCTTTCAGTACAAATCCCTGTTACTTCTTGAGAGCTTACAGGCCCTGGAAAGTTACCTATGGCCC
AGTTACTCAGAGCAGTCGTCCAACTATCACGTCTTGTTGATGGCACTCATAGCAAACGCCAAGAGGCGGGAGCAT
TTAGACACATGGAATATATTCGAGGACAGGCCCGACGACTTCTCGTCCATGTTTCGCCAACTCAACTAG
Transcript >Hirsu2|2593
ATGCCTAATGCGAAGCGGCTCAAGAGCAGCGGCTTTACCAGGCCCCGGCAGGCCAAGGAAACTGGCTCTCAGACC
GAAGTTGGCCGGCCGACTCCCGCCGAGGTTGAAGAAAAAGAGCATCAGTTTGTCCAACTGGCTCGGAAGCATTGG
CTCAAGCCTGGGAAGAGAACGACCAGGCCCAAGGTCAAGAACGAGGTCCTCAAACAGAGTATATGGGACGTGCTC
GACAAGGAGGGCTTTCAGTACAAATCCCTGTTACTTCTTGAGAGCTTACAGGCCCTGGAAAGTTACCTATGGCCC
AGTTACTCAGAGCAGTCGTCCAACTATCACGTCTTGTTGATGGCACTCATAGCAAACGCCAAGAGGCGGGAGCAT
TTAGACACATGGAATATATTCGAGGACAGGCCCGACGACTTCTCGTCCATGTTTCGCCAACTCAACTAG
Gene >Hirsu2|2593
ATGCCTAATGCGAAGCGGCTCAAGAGCAGCGGCTTTACCAGGCCCCGGCAGGCCAAGGAAACTGGCTCTCAGACC
GAAGTTGGCCGGCCGACTCCCGCCGAGGTTGAAGAAAAAGAGCATCAGTTTGTCCAACTGGCTCGGAAGCATTGG
CTCAAGCCTGGGAAGAGAACGACCAGGCCCAAGGTCAAGAACGAGGTCCTCAAACAGAGTATATGGGACGTGCTC
GACAAGGAGGGCTTTCAGTACAAATCCCTGTTACTTCTTGAGAGCTTACAGGCCCTGGAAAGGTATGCCCACCTC
ACCTATTCTCCACGGGACAACTGCCCAGTTCTGATTTTTTTTCCCCCAATCAGTTACCTATGGCCCAGTTACTCA
GAGCAGTCGTCCAACTATCACGTCTTGTTGATGGCACTCATAGCAAACGCCAAGAGGCGGGAGCATTTAGACACA
TGGAGTGAGTGGAAACTATCACTGCCCCAACCTTTCGTTTCTGACTGTCTCAAGATATATTCGAGGACAGGCCCG
ACGACTTCTCGTCCATGTTTCGCCGTATCCTCTCCTTGACGCTGGATCGCACGTTGCCAACATACATTAGAACTC
AACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail