Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|259
Gene name
LocationContig_1048:6258..8161
Strand-
Gene length (bp)1903
Transcript length (bp)1689
Coding sequence length (bp)1689
Protein length (aa) 563

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4478 0.7506 0.0433 0.0214 0.0429 0.0009 0.0581 0.0938 0.0762 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5029
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5445
Ophiocordyceps australis map64 (Brazil) OphauB2|3903
Ophiocordyceps camponoti-floridani Ophcf2|03913
Ophiocordyceps kimflemingae Ophio5|6933
Ophiocordyceps subramaniannii Hirsu2|259 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|259
MYSANYGFGNAPFNPAAPPPPPQQQQQQHQQQPPPPQHQQPPHQQHHQQHPQQPHHPPPPPGQQMMYSQQQPHQQ
HQQHQQHQQHQQHQQHQQHQQHQQHQQHQQQPQPGQPQQQQYAGIAPQPAFNPAANPQMMQGMPAGMMQNPGMPG
MAPNGQIPGYPQQFLAPPYGQMMPQSMPQNFAPNNYMMHGGMQGFPMNQPGMPQQQAHMMQRMQAQAQAQAHAQA
QAQVHAQAQSQAQAQQANPAMNQASTPQRPPSAPQGTPNNPMGGQQQFSTPQPPSQNATPNSAQHQQQQQQQHAA
QQHPHHPQQQHQQQPHQQHHPQQHQHQQHQQQQQQQQQQQQHLGGMATPQTPTFSANHGGGMSLPASVPPMSPAA
ESREKERFALLLDINHELLYESIQIQTTQQELKKELAAAGGNSADRKPSEEENLFQQDYLQCMRRLQTNLSYMAA
LADRKPEVKAPPCPAYLSPPPLNLTLRLRAQPIGAEGMDINVDPMADRAERDKSIRDLYRRLQAVFPSFDPKKEP
VFGRPPTGQKPHQVSPTVQQAPQMPPMPAPPGHLGGM*
Coding >Hirsu2|259
ATGTATTCTGCCAACTATGGCTTCGGCAACGCGCCCTTCAACCCCGCGGCACCGCCGCCGCCGCCTCAGCAGCAG
CAGCAGCAGCATCAGCAGCAGCCGCCGCCGCCACAACACCAGCAGCCTCCCCATCAGCAGCATCACCAGCAGCAT
CCGCAGCAACCGCACCATCCGCCGCCGCCGCCGGGCCAGCAGATGATGTACAGCCAGCAGCAACCGCATCAGCAG
CACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCAC
CAGCAGCACCAGCAGCAGCCCCAGCCGGGGCAGCCGCAACAGCAGCAGTACGCCGGCATCGCGCCCCAGCCCGCC
TTCAACCCGGCCGCCAATCCCCAGATGATGCAGGGCATGCCTGCGGGCATGATGCAGAATCCGGGCATGCCCGGC
ATGGCTCCCAACGGACAGATTCCCGGCTACCCGCAGCAGTTCCTCGCCCCCCCCTACGGCCAGATGATGCCGCAG
TCCATGCCCCAGAACTTCGCGCCGAACAACTACATGATGCACGGCGGCATGCAGGGCTTCCCCATGAACCAGCCC
GGCATGCCTCAGCAGCAGGCACACATGATGCAGCGCATGCAGGCCCAGGCCCAAGCCCAAGCCCACGCGCAGGCC
CAGGCTCAGGTCCATGCCCAGGCGCAATCGCAGGCTCAGGCACAGCAGGCGAACCCGGCCATGAACCAGGCTTCG
ACTCCGCAGAGACCGCCCAGCGCGCCCCAGGGCACCCCGAACAACCCGATGGGCGGCCAGCAGCAGTTCTCGACG
CCCCAGCCCCCGTCTCAGAACGCGACGCCGAACAGCGCGCAGCATCAGCAGCAGCAGCAACAGCAACATGCTGCG
CAACAGCATCCGCATCACCCACAGCAGCAGCACCAGCAGCAGCCACATCAACAGCACCACCCGCAACAGCACCAG
CACCAGCAGCACCAGCAGCAACAGCAGCAGCAACAACAACAGCAGCAGCACCTCGGCGGCATGGCGACTCCGCAG
ACGCCCACCTTTTCCGCCAACCACGGGGGGGGCATGAGCCTGCCGGCGTCGGTGCCGCCCATGAGCCCGGCCGCC
GAGTCGCGGGAAAAGGAGCGGTTCGCACTGCTGCTGGACATCAACCACGAGCTGCTGTACGAGTCGATCCAGATC
CAGACGACGCAGCAGGAGCTCAAAAAGGAACTCGCGGCCGCGGGCGGCAACTCGGCCGACCGGAAGCCGTCGGAA
GAGGAAAATCTCTTCCAACAGGATTATCTGCAGTGCATGCGGCGGCTGCAGACGAACCTCTCGTACATGGCGGCC
CTGGCCGACCGGAAGCCAGAGGTCAAGGCGCCTCCTTGTCCGGCCTACCTGAGCCCCCCGCCGCTCAACCTGACG
CTGAGGCTTCGGGCGCAGCCGATCGGGGCCGAGGGCATGGACATCAACGTCGACCCCATGGCCGACCGGGCGGAG
CGCGACAAGTCGATCCGCGACCTCTACCGGCGGCTGCAGGCCGTCTTCCCCAGCTTCGACCCCAAGAAGGAGCCC
GTCTTCGGACGGCCGCCGACGGGACAGAAGCCGCACCAGGTCAGCCCGACGGTGCAGCAAGCGCCGCAGATGCCG
CCCATGCCGGCGCCTCCGGGGCACCTGGGCGGCATGTGA
Transcript >Hirsu2|259
ATGTATTCTGCCAACTATGGCTTCGGCAACGCGCCCTTCAACCCCGCGGCACCGCCGCCGCCGCCTCAGCAGCAG
CAGCAGCAGCATCAGCAGCAGCCGCCGCCGCCACAACACCAGCAGCCTCCCCATCAGCAGCATCACCAGCAGCAT
CCGCAGCAACCGCACCATCCGCCGCCGCCGCCGGGCCAGCAGATGATGTACAGCCAGCAGCAACCGCATCAGCAG
CACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCAC
CAGCAGCACCAGCAGCAGCCCCAGCCGGGGCAGCCGCAACAGCAGCAGTACGCCGGCATCGCGCCCCAGCCCGCC
TTCAACCCGGCCGCCAATCCCCAGATGATGCAGGGCATGCCTGCGGGCATGATGCAGAATCCGGGCATGCCCGGC
ATGGCTCCCAACGGACAGATTCCCGGCTACCCGCAGCAGTTCCTCGCCCCCCCCTACGGCCAGATGATGCCGCAG
TCCATGCCCCAGAACTTCGCGCCGAACAACTACATGATGCACGGCGGCATGCAGGGCTTCCCCATGAACCAGCCC
GGCATGCCTCAGCAGCAGGCACACATGATGCAGCGCATGCAGGCCCAGGCCCAAGCCCAAGCCCACGCGCAGGCC
CAGGCTCAGGTCCATGCCCAGGCGCAATCGCAGGCTCAGGCACAGCAGGCGAACCCGGCCATGAACCAGGCTTCG
ACTCCGCAGAGACCGCCCAGCGCGCCCCAGGGCACCCCGAACAACCCGATGGGCGGCCAGCAGCAGTTCTCGACG
CCCCAGCCCCCGTCTCAGAACGCGACGCCGAACAGCGCGCAGCATCAGCAGCAGCAGCAACAGCAACATGCTGCG
CAACAGCATCCGCATCACCCACAGCAGCAGCACCAGCAGCAGCCACATCAACAGCACCACCCGCAACAGCACCAG
CACCAGCAGCACCAGCAGCAACAGCAGCAGCAACAACAACAGCAGCAGCACCTCGGCGGCATGGCGACTCCGCAG
ACGCCCACCTTTTCCGCCAACCACGGGGGGGGCATGAGCCTGCCGGCGTCGGTGCCGCCCATGAGCCCGGCCGCC
GAGTCGCGGGAAAAGGAGCGGTTCGCACTGCTGCTGGACATCAACCACGAGCTGCTGTACGAGTCGATCCAGATC
CAGACGACGCAGCAGGAGCTCAAAAAGGAACTCGCGGCCGCGGGCGGCAACTCGGCCGACCGGAAGCCGTCGGAA
GAGGAAAATCTCTTCCAACAGGATTATCTGCAGTGCATGCGGCGGCTGCAGACGAACCTCTCGTACATGGCGGCC
CTGGCCGACCGGAAGCCAGAGGTCAAGGCGCCTCCTTGTCCGGCCTACCTGAGCCCCCCGCCGCTCAACCTGACG
CTGAGGCTTCGGGCGCAGCCGATCGGGGCCGAGGGCATGGACATCAACGTCGACCCCATGGCCGACCGGGCGGAG
CGCGACAAGTCGATCCGCGACCTCTACCGGCGGCTGCAGGCCGTCTTCCCCAGCTTCGACCCCAAGAAGGAGCCC
GTCTTCGGACGGCCGCCGACGGGACAGAAGCCGCACCAGGTCAGCCCGACGGTGCAGCAAGCGCCGCAGATGCCG
CCCATGCCGGCGCCTCCGGGGCACCTGGGCGGCATGTGA
Gene >Hirsu2|259
ATGTATTCTGCCAACTATGGCTTCGGCAACGCGCCCTTCAACCCCGCGGCACCGCCGCCGCCGCCTCAGCAGCAG
CAGCAGCAGCATCAGCAGCAGCCGCCGCCGCCACAACACCAGCAGCCTCCCCATCAGCAGCATCACCAGCAGCAT
CCGCAGCAACCGCACCATCCGCCGCCGCCGCCGGGCCAGCAGATGATGTACAGCCAGCAGCAACCGCATCAGCAG
CACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCACCAGCAGCAC
CAGCAGCACCAGCAGCAGCCCCAGCCGGGGCAGCCGCAACAGCAGCAGTACGCCGGCATCGCGCCCCAGCCCGCC
TTCAACCCGGCCGCCAATCCCCAGATGATGCAGGGCATGCCTGCGGGCATGATGCAGAATCCGGGCATGCCCGGC
ATGGCTCCCAACGGACAGAGTGAGCGAGCCCCGAGCCTTGCACTCCCCTCTCCATTCCTCCCCCCTTGCCACCCC
TCCCTCCTTCCAGGCCGCCGAAGCGTGTGGCGCCCGCTGACCGGCGACGGCCCCAGTTCCCGGCTACCCGCAGCA
GTTCCTCGCCCCCCCCTACGGCCAGATGATGCCGCAGTCCATGCCCCAGAACTTCGCGCCGAACAACTACATGAT
GCACGGCGGCATGCAGGGCTTCCCCATGAACCAGCCCGGCATGCCTCAGCAGCAGGCACACATGATGCAGCGCAT
GCAGGCCCAGGCCCAAGCCCAAGCCCACGCGCAGGCCCAGGCTCAGGTCCATGCCCAGGCGCAATCGCAGGCTCA
GGCACAGCAGGCGAACCCGGCCATGAACCAGGCTTCGACTCCGCAGAGACCGCCCAGCGCGCCCCAGGGCACCCC
GAACAACCCGATGGGCGGCCAGCAGCAGTTCTCGACGCCCCAGCCCCCGTCTCAGAACGCGACGCCGAACAGCGC
GCAGCATCAGCAGCAGCAGCAACAGCAACATGCTGCGCAACAGCATCCGCATCACCCACAGCAGCAGCACCAGCA
GCAGCCACATCAACAGCACCACCCGCAACAGCACCAGCACCAGCAGCACCAGCAGCAACAGCAGCAGCAACAACA
ACAGCAGCAGCACCTCGGCGGCATGGCGACTCCGCAGACGCCCACCTTTTCCGCCAACCACGGGGGGGGCATGAG
CCTGCCGGCGTCGGTGCCGCCCATGAGCCCGGCCGCCGAGTCGCGGGAAAAGGAGCGGTTCGCACTGCTGCTGGA
CATCAACCACGAGCTGCTGTACGAGTCGATCCAGATCCAGACGACGCAGCAGGAGCTCAAAAAGGAACTCGCGGC
CGCGGGCGGCAACTCGGCCGACCGGAAGCCGTCGGAAGAGGAAAATCTCTTCCAACAGGATTATCTGCAGTAAGT
CTTTCTTTTTTTTTCTCTCTCTCCGCGGCGGCTGCGGCGGCGCGATGGCCGCGAGACTCAGGCGCGGCTAACACC
GGAGGGGGGGGGGGGTTCCAGGTGCATGCGGCGGCTGCAGACGAACCTCTCGTACATGGCGGCCCTGGCCGACCG
GAAGCCAGAGGTCAAGGCGCCTCCTTGTCCGGCCTACCTGAGCCCCCCGCCGCTCAACCTGACGCTGAGGCTTCG
GGCGCAGCCGATCGGGGCCGAGGGCATGGACATCAACGTCGACCCCATGGCCGACCGGGCGGAGCGCGACAAGTC
GATCCGCGACCTCTACCGGCGGCTGCAGGCCGTCTTCCCCAGCTTCGACCCCAAGAAGGAGCCCGTCTTCGGACG
GCCGCCGACGGGACAGAAGCCGCACCAGGTCAGCCCGACGGTGCAGCAAGCGCCGCAGATGCCGCCCATGCCGGC
GCCTCCGGGGCACCTGGGCGGCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail