Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2582
Gene name
LocationContig_162:22900..23982
Strand+
Gene length (bp)1082
Transcript length (bp)906
Coding sequence length (bp)906
Protein length (aa) 302

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 1.7E-07 248 295
PF07653 SH3_2 Variant SH3 domain 7.4E-05 252 298

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E9EM69|SHO1_METRA High osmolarity signaling protein MOS1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=MOS1 PE=2 SV=1 1 301 3.0E-166
sp|C7Z504|SHO1_NECH7 High osmolarity signaling protein SHO1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=SHO1 PE=3 SV=1 7 301 7.0E-157
sp|Q2KEW0|SHO1_MAGO7 High osmolarity signaling protein SHO1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SHO1 PE=3 SV=1 1 301 2.0E-137
sp|B2ANF9|SHO1_PODAN High osmolarity signaling protein SHO1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SHO1 PE=3 SV=1 1 301 1.0E-128
sp|Q2H3I7|SHO1_CHAGB High osmolarity signaling protein SHO1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SHO1 PE=3 SV=1 1 301 4.0E-126
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E9EM69|SHO1_METRA High osmolarity signaling protein MOS1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=MOS1 PE=2 SV=1 1 301 3.0E-166
sp|C7Z504|SHO1_NECH7 High osmolarity signaling protein SHO1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=SHO1 PE=3 SV=1 7 301 7.0E-157
sp|Q2KEW0|SHO1_MAGO7 High osmolarity signaling protein SHO1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SHO1 PE=3 SV=1 1 301 2.0E-137
sp|B2ANF9|SHO1_PODAN High osmolarity signaling protein SHO1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=SHO1 PE=3 SV=1 1 301 1.0E-128
sp|Q2H3I7|SHO1_CHAGB High osmolarity signaling protein SHO1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SHO1 PE=3 SV=1 1 301 4.0E-126
sp|E3QNZ1|SHO1_COLGM High osmolarity signaling protein SHO1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=SHO1 PE=3 SV=1 1 301 2.0E-123
sp|A7F1F4|SHO1_SCLS1 High osmolarity signaling protein sho1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=sho1 PE=3 SV=1 9 301 1.0E-117
sp|C9SA05|SHO1_VERA1 High osmolarity signaling protein SHO1 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=SHO1 PE=3 SV=1 1 301 1.0E-117
sp|D1ZRK4|SHO1_SORMK High osmolarity signaling protein SHO1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SHO1 PE=3 SV=1 1 301 5.0E-112
sp|Q2U7N9|SHO1_ASPOR High osmolarity signaling protein sho1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=sho1 PE=3 SV=1 14 301 1.0E-110
sp|B8NEM4|SHO1_ASPFN High osmolarity signaling protein sho1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=sho1 PE=3 SV=1 13 301 1.0E-110
sp|Q7SGL6|SHO1_NEUCR High osmolarity signaling protein sho1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sho1 PE=3 SV=2 1 301 8.0E-110
sp|B2VV00|SHO1_PYRTR High osmolarity signaling protein sho1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=sho1 PE=3 SV=1 7 301 9.0E-110
sp|E3RIP0|SHO1_PYRTT High osmolarity signaling protein sho1 OS=Pyrenophora teres f. teres (strain 0-1) GN=sho1 PE=3 SV=1 7 301 6.0E-109
sp|E5AD87|SHO1_LEPMJ High osmolarity signaling protein SHO1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=SHO1 PE=3 SV=1 1 301 2.0E-105
sp|D6PVB5|SHO1B_HORWE High osmolarity signaling protein SHO1B OS=Hortaea werneckii GN=SHO1B PE=3 SV=1 13 301 5.0E-105
sp|B6HR44|SHO1_PENRW High osmolarity signaling protein sho1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=sho1 PE=3 SV=1 14 301 5.0E-104
sp|A1DEZ0|SHO1_NEOFI High osmolarity signaling protein sho1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=sho1 PE=3 SV=1 14 301 5.0E-104
sp|D6PVB4|SHO1A_HORWE High osmolarity signaling protein SHO1A OS=Hortaea werneckii GN=SHO1A PE=3 SV=1 13 301 9.0E-104
sp|B6QEE0|SHO1_TALMQ High osmolarity signaling protein sho1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sho1 PE=3 SV=1 17 301 2.0E-103
sp|A2QGW1|SHO1_ASPNC High osmolarity signaling protein sho1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sho1 PE=3 SV=1 14 301 4.0E-101
sp|A1CAL7|SHO1_ASPCL High osmolarity signaling protein sho1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sho1 PE=3 SV=1 14 301 1.0E-100
sp|Q4WUG9|SHO1_ASPFU High osmolarity signaling protein sho1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=sho1 PE=3 SV=2 14 301 2.0E-100
sp|B0Y3Z4|SHO1_ASPFC High osmolarity signaling protein sho1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=sho1 PE=3 SV=2 14 301 2.0E-100
sp|C4JLG3|SHO1_UNCRE High osmolarity signaling protein SHO1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SHO1 PE=3 SV=1 13 301 5.0E-99
sp|C5JGE5|SHO1_AJEDS High osmolarity signaling protein SHO1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SHO1 PE=3 SV=1 13 301 7.0E-96
sp|C5GIQ8|SHO1_AJEDR High osmolarity signaling protein SHO1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SHO1 PE=3 SV=1 13 301 7.0E-96
sp|C0S7Q7|SHO1_PARBP High osmolarity signaling protein SHO1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SHO1 PE=3 SV=1 13 301 9.0E-96
sp|C1GJ63|SHO1_PARBD High osmolarity signaling protein SHO1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SHO1 PE=3 SV=2 13 301 9.0E-96
sp|C6HFQ7|SHO1_AJECH High osmolarity signaling protein SHO1 OS=Ajellomyces capsulatus (strain H143) GN=SHO1 PE=3 SV=1 1 301 2.0E-94
sp|C5FH98|SHO1_ARTOC High osmolarity signaling protein SHO1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SHO1 PE=3 SV=1 14 301 2.0E-94
sp|D4DA58|SHO1_TRIVH High osmolarity signaling protein SHO1 OS=Trichophyton verrucosum (strain HKI 0517) GN=SHO1 PE=3 SV=1 14 301 1.0E-92
sp|D4ARB8|SHO1_ARTBC High osmolarity signaling protein SHO1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SHO1 PE=3 SV=1 14 301 1.0E-92
sp|Q5AVI2|SHO1_EMENI High osmolarity signaling protein sho1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sho1 PE=3 SV=1 13 301 8.0E-92
sp|B8MD74|SHO1_TALSN High osmolarity signaling protein sho1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sho1 PE=3 SV=1 17 301 3.0E-91
sp|A6QTM4|SHO1_AJECN High osmolarity signaling protein SHO1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SHO1 PE=3 SV=1 13 301 7.0E-89
sp|B8R1V5|SHO1_CLALS High osmolarity signaling protein SHO1 OS=Clavispora lusitaniae GN=SHO1 PE=3 SV=1 12 301 1.0E-62
sp|C4Y1G1|SHO1_CLAL4 High osmolarity signaling protein SHO1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=SHO1 PE=3 SV=1 12 301 1.0E-62
sp|Q6CAC5|SHO1_YARLI High osmolarity signaling protein SHO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SHO1 PE=3 SV=1 10 301 5.0E-62
sp|Q9P864|SHO1_CYBJA High osmolarity signaling protein SHO1 OS=Cyberlindnera jadinii GN=SHO1 PE=3 SV=1 2 301 4.0E-57
sp|Q6BVC2|SHO1_DEBHA High osmolarity signaling protein SHO1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SHO1 PE=3 SV=1 15 301 3.0E-55
sp|A5E1V8|SHO1_LODEL High osmolarity signaling protein SHO1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=SHO1 PE=3 SV=1 12 301 4.0E-55
sp|A5DR93|SHO1_PICGU High osmolarity signaling protein SHO1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=SHO1 PE=3 SV=2 12 301 9.0E-53
sp|C4QVD6|SHO1_PICPG High osmolarity signaling protein SHO1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SHO1 PE=3 SV=1 13 298 3.0E-52
sp|C5MB30|SHO1_CANTT High osmolarity signaling protein SHO1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=SHO1 PE=3 SV=1 12 301 2.0E-47
sp|Q6CP77|SHO1_KLULA High osmolarity signaling protein SHO1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SHO1 PE=3 SV=1 15 301 7.0E-47
sp|C5DE38|SHO1_LACTC High osmolarity signaling protein SHO1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=SHO1 PE=3 SV=1 13 301 1.0E-45
sp|C5DQY5|SHO1_ZYGRC High osmolarity signaling protein SHO1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=SHO1 PE=3 SV=1 15 301 1.0E-44
sp|Q6FTC4|SHO1_CANGA High osmolarity signaling protein SHO1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SHO1 PE=3 SV=1 5 301 2.0E-44
sp|Q751J2|SHO1_ASHGO High osmolarity signaling protein SHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SHO1 PE=3 SV=1 15 301 3.0E-44
sp|E7RAI2|SHO1_OGAPD High osmolarity signaling protein SHO1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=SHO1 PE=3 SV=1 19 301 7.0E-40
sp|B3LRN4|SHO1_YEAS1 High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SHO1 PE=3 SV=1 14 301 1.0E-38
sp|E7Q311|SHO1_YEASB High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain FostersB) GN=SHO1 PE=3 SV=1 14 301 1.0E-38
sp|C7GKW5|SHO1_YEAS2 High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain JAY291) GN=SHO1 PE=3 SV=1 14 301 1.0E-38
sp|A6ZR73|SHO1_YEAS7 High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHO1 PE=3 SV=1 14 301 2.0E-38
sp|E7QE10|SHO1_YEASZ High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain Zymaflore VL3) GN=SHO1 PE=3 SV=1 14 301 2.0E-38
sp|E7LTJ6|SHO1_YEASV High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain VIN 13) GN=SHO1 PE=3 SV=1 14 301 2.0E-38
sp|E7KMS3|SHO1_YEASL High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain Lalvin QA23) GN=SHO1 PE=3 SV=1 14 301 2.0E-38
sp|E7KBW4|SHO1_YEASA High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain AWRI796) GN=SHO1 PE=3 SV=1 14 301 2.0E-38
sp|B5VHP4|SHO1_YEAS6 High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=SHO1 PE=3 SV=1 14 301 2.0E-38
sp|P40073|SHO1_YEAST High osmolarity signaling protein SHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHO1 PE=1 SV=1 14 301 1.0E-37
sp|A7TI28|SHO1_VANPO High osmolarity signaling protein SHO1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=SHO1 PE=3 SV=1 10 301 1.0E-36
sp|D8PSG0|SHO1_SCHCM High osmolarity signaling protein SHO1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=SHO1 PE=3 SV=1 9 301 7.0E-35
sp|E6RET3|SHO1_CRYGW High osmolarity signaling protein SHO1 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=SHO1 PE=3 SV=1 7 301 5.0E-24
sp|B9W8T5|SHO1_CANDC High osmolarity signaling protein SHO1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SHO1 PE=3 SV=1 234 301 1.0E-23
sp|C4YDC4|SHO1_CANAW High osmolarity signaling protein SHO1 OS=Candida albicans (strain WO-1) GN=SHO1 PE=3 SV=1 234 301 1.0E-23
sp|Q5AQ36|SHO1_CANAL High osmolarity signaling protein SHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHO1 PE=2 SV=1 234 301 2.0E-23
sp|Q5AQ36|SHO1_CANAL High osmolarity signaling protein SHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SHO1 PE=2 SV=1 12 153 1.0E-20
sp|E7A253|SHO1_SPORE High osmolarity signaling protein SHO1 OS=Sporisorium reilianum (strain SRZ2) GN=SHO1 PE=3 SV=1 183 301 1.0E-20
sp|C4YDC4|SHO1_CANAW High osmolarity signaling protein SHO1 OS=Candida albicans (strain WO-1) GN=SHO1 PE=3 SV=1 12 153 2.0E-20
sp|B9W8T5|SHO1_CANDC High osmolarity signaling protein SHO1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=SHO1 PE=3 SV=1 12 153 2.0E-19
sp|Q4P9Q7|SHO1_USTMA High osmolarity signaling protein SHO1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SHO1 PE=3 SV=1 227 301 1.0E-18
sp|E7A253|SHO1_SPORE High osmolarity signaling protein SHO1 OS=Sporisorium reilianum (strain SRZ2) GN=SHO1 PE=3 SV=1 35 142 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22
2 58 77 19
3 87 109 22
4 116 138 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2582
MEHSRSYGGRKGIRLGNILGDPFALATISISLLAWFITFISCIISQVQATGNEPFPSFAWWAAVYSLFLIVGIFV
VVASDSVQTYHVAVTGYLAGGMVLVTSSVNLLVYSKSGAREAAAAGFILLSMVVIVWIFYFGSTPSSTPRAFLDS
FALAKDSGPMPGQAMNGYGGTGRPETSNSVQPPQMYTSAQLNGFENSSPIGAGGGAPMNGPRASAMPTGFGSGSV
QPQQPKANDAEVVTPTEYPYQAKAIYSYEANPDDANEISFVKHEVLEVSDVSGRWWQARKQNGDIGIAPSNYLIL
L*
Coding >Hirsu2|2582
ATGGAACATTCGCGCTCCTATGGGGGGCGTAAGGGCATCCGGCTCGGCAACATCCTCGGCGACCCCTTCGCCCTG
GCCACCATTTCCATCTCGCTCCTTGCATGGTTCATCACCTTCATCTCGTGCATAATTTCCCAAGTGCAGGCCACC
GGCAACGAACCCTTCCCCTCCTTTGCCTGGTGGGCCGCCGTCTACAGCCTGTTCCTCATCGTCGGCATCTTCGTC
GTCGTCGCCAGCGACTCCGTCCAGACCTACCATGTCGCCGTCACCGGCTACCTCGCCGGCGGCATGGTCCTCGTC
ACTTCGTCCGTCAACCTGCTCGTCTACTCCAAGAGCGGCGCCCGCGAGGCCGCCGCCGCCGGCTTCATCCTGCTG
TCCATGGTGGTGATTGTCTGGATCTTCTACTTCGGCTCCACGCCGTCCTCGACGCCCCGCGCCTTCCTCGACTCC
TTCGCCCTGGCCAAGGACTCGGGCCCGATGCCCGGCCAGGCCATGAACGGCTACGGCGGCACCGGCCGCCCCGAG
ACGTCCAACTCGGTCCAGCCTCCCCAGATGTACACGTCAGCTCAGCTCAACGGCTTCGAGAACTCGTCGCCCATC
GGCGCCGGCGGCGGCGCCCCGATGAACGGCCCCCGCGCCTCCGCCATGCCCACCGGCTTCGGCAGCGGCTCCGTC
CAGCCCCAGCAACCAAAGGCCAACGACGCCGAGGTCGTGACCCCGACCGAGTACCCCTACCAGGCCAAGGCCATC
TACAGCTACGAGGCCAACCCCGACGACGCCAACGAGATCTCCTTCGTCAAGCACGAGGTCCTCGAAGTTTCCGAC
GTCAGCGGACGGTGGTGGCAGGCGCGCAAACAAAACGGCGACATCGGAATCGCCCCCAGCAACTACCTCATCTTA
TTATGA
Transcript >Hirsu2|2582
ATGGAACATTCGCGCTCCTATGGGGGGCGTAAGGGCATCCGGCTCGGCAACATCCTCGGCGACCCCTTCGCCCTG
GCCACCATTTCCATCTCGCTCCTTGCATGGTTCATCACCTTCATCTCGTGCATAATTTCCCAAGTGCAGGCCACC
GGCAACGAACCCTTCCCCTCCTTTGCCTGGTGGGCCGCCGTCTACAGCCTGTTCCTCATCGTCGGCATCTTCGTC
GTCGTCGCCAGCGACTCCGTCCAGACCTACCATGTCGCCGTCACCGGCTACCTCGCCGGCGGCATGGTCCTCGTC
ACTTCGTCCGTCAACCTGCTCGTCTACTCCAAGAGCGGCGCCCGCGAGGCCGCCGCCGCCGGCTTCATCCTGCTG
TCCATGGTGGTGATTGTCTGGATCTTCTACTTCGGCTCCACGCCGTCCTCGACGCCCCGCGCCTTCCTCGACTCC
TTCGCCCTGGCCAAGGACTCGGGCCCGATGCCCGGCCAGGCCATGAACGGCTACGGCGGCACCGGCCGCCCCGAG
ACGTCCAACTCGGTCCAGCCTCCCCAGATGTACACGTCAGCTCAGCTCAACGGCTTCGAGAACTCGTCGCCCATC
GGCGCCGGCGGCGGCGCCCCGATGAACGGCCCCCGCGCCTCCGCCATGCCCACCGGCTTCGGCAGCGGCTCCGTC
CAGCCCCAGCAACCAAAGGCCAACGACGCCGAGGTCGTGACCCCGACCGAGTACCCCTACCAGGCCAAGGCCATC
TACAGCTACGAGGCCAACCCCGACGACGCCAACGAGATCTCCTTCGTCAAGCACGAGGTCCTCGAAGTTTCCGAC
GTCAGCGGACGGTGGTGGCAGGCGCGCAAACAAAACGGCGACATCGGAATCGCCCCCAGCAACTACCTCATCTTA
TTATGA
Gene >Hirsu2|2582
ATGGAACATTCGCGCTCCTATGGGGGGCGTAAGGGCATCCGGCTCGGCAACATCCTCGGCGACCCCTTCGCCCTG
GCCACCATTTCCATCTCGCTCGTACGTCGGCCATCCATCCGCCCAGCACGTCCGCTCCCTTCTCCACCCCTGCAT
GACACGCCAATTCCTGCCTCGAGATCCCCTCTCTTGCTTGGCCGTGGCTAATTAGCGCGTCCCCCACAGCTTGCA
TGGTTCATCACCTTCATCTCGTGCATAATTTCCCAAGTGCAGGCCACCGGCAACGAACCCTTCCCCTCCTTTGCC
TGGTGGGCCGCCGTCTACAGCCTGTTCCTCATCGTCGGCATCTTCGTCGTCGTCGCCAGCGACTCCGTCCAGACC
TACCATGTCGCCGTCACCGGCTACCTCGCCGGCGGCATGGTCCTCGTCACTTCGTCCGTCAACCTGCTCGTCTAC
TCCAAGAGCGGCGCCCGCGAGGCCGCCGCCGCCGGCTTCATCCTGCTGTCCATGGTGGTGGTGAGCAGCCCGCCC
CCTGGACACGACGCTCCCGCCCTTGCTGACTGCCGCAGATTGTCTGGATCTTCTACTTCGGCTCCACGCCGTCCT
CGACGCCCCGCGCCTTCCTCGACTCCTTCGCCCTGGCCAAGGACTCGGGCCCGATGCCCGGCCAGGCCATGAACG
GCTACGGCGGCACCGGCCGCCCCGAGACGTCCAACTCGGTCCAGCCTCCCCAGATGTACACGTCAGCTCAGCTCA
ACGGCTTCGAGAACTCGTCGCCCATCGGCGCCGGCGGCGGCGCCCCGATGAACGGCCCCCGCGCCTCCGCCATGC
CCACCGGCTTCGGCAGCGGCTCCGTCCAGCCCCAGCAACCAAAGGCCAACGACGCCGAGGTCGTGACCCCGACCG
AGTACCCCTACCAGGCCAAGGCCATCTACAGCTACGAGGCCAACCCCGACGACGCCAACGAGATCTCCTTCGTCA
AGCACGAGGTCCTCGAAGTTTCCGACGTCAGCGGACGGTGGTGGCAGGCGCGCAAACAAAACGGCGACATCGGAA
TCGCCCCCAGCAACTACCTCATCTTATTATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail