Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|258
Gene name
LocationContig_1048:45..4742
Strand-
Gene length (bp)4697
Transcript length (bp)4530
Coding sequence length (bp)4530
Protein length (aa) 1510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 1.6E-83 571 774
PF02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain 8.6E-27 1109 1309
PF00988 CPSase_sm_chain Carbamoyl-phosphate synthase small chain, CPSase domain 2.4E-46 23 161
PF00117 GATase Glutamine amidotransferase class-I 2.7E-44 240 417
PF02787 CPSase_L_D3 Carbamoyl-phosphate synthetase large chain, oligomerisation domain 1.3E-37 860 982
PF02142 MGS MGS-like domain 8.0E-22 1389 1486
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 6.8E-06 596 741
PF07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus 5.3E-07 1121 1277
PF02222 ATP-grasp ATP-grasp domain 3.9E-05 585 721
PF02222 ATP-grasp ATP-grasp domain 1.4E-07 1118 1279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 6 1507 0.0E+00
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 16 1502 0.0E+00
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 3 1509 0.0E+00
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 23 1499 0.0E+00
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 21 1498 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O93937|PYR1_EMENI Protein pyrABCN OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pyrABCN PE=3 SV=2 6 1507 0.0E+00
sp|Q09794|PYR1_SCHPO Protein ura1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura1 PE=1 SV=1 16 1502 0.0E+00
sp|P07259|PYR1_YEAST Protein URA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA2 PE=1 SV=5 3 1509 0.0E+00
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 23 1499 0.0E+00
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 21 1498 0.0E+00
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 21 1500 0.0E+00
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 21 1500 0.0E+00
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 21 1500 0.0E+00
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 24 1498 0.0E+00
sp|P31327|CPSM_HUMAN Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2 26 1507 0.0E+00
sp|Q8C196|CPSM_MOUSE Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Mus musculus GN=Cps1 PE=1 SV=2 26 1507 0.0E+00
sp|P07756|CPSM_RAT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Rattus norvegicus GN=Cps1 PE=1 SV=1 26 1507 0.0E+00
sp|Q91293|CPSM_LITCT Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Lithobates catesbeiana PE=2 SV=1 9 1507 0.0E+00
sp|O94313|CARB_SCHPO Carbamoyl-phosphate synthase arginine-specific large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg4 PE=3 SV=1 459 1498 0.0E+00
sp|P46056|CARB_TRICU Carbamoyl-phosphate synthase arginine-specific large chain OS=Trichosporon cutaneum GN=argA PE=3 SV=1 452 1500 0.0E+00
sp|Q75D66|CARB_ASHGO Carbamoyl-phosphate synthase arginine-specific large chain OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPA2 PE=3 SV=2 452 1509 0.0E+00
sp|P03965|CARB_YEAST Carbamoyl-phosphate synthase arginine-specific large chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPA2 PE=1 SV=1 436 1502 0.0E+00
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q469Z7|CARB_METBF Carbamoyl-phosphate synthase large chain OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=carB PE=3 SV=1 449 1489 0.0E+00
sp|Q4J8E8|CARB_SULAC Carbamoyl-phosphate synthase large chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carB PE=3 SV=1 449 1497 0.0E+00
sp|P58944|CARB_METMA Carbamoyl-phosphate synthase large chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=carB PE=3 SV=1 449 1489 0.0E+00
sp|Q970U7|CARB_SULTO Carbamoyl-phosphate synthase large chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carB PE=3 SV=1 449 1487 0.0E+00
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 452 1500 0.0E+00
sp|A2BJL3|CARB_HYPBU Carbamoyl-phosphate synthase large chain OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|B9EB69|CARB_MACCJ Carbamoyl-phosphate synthase large chain OS=Macrococcus caseolyticus (strain JCSC5402) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 451 1498 0.0E+00
sp|Q1WVA9|CARB_LACS1 Carbamoyl-phosphate synthase large chain OS=Lactobacillus salivarius (strain UCC118) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q8TNY4|CARB_METAC Carbamoyl-phosphate synthase large chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=carB PE=3 SV=1 449 1489 0.0E+00
sp|B0KBW4|CARB_THEP3 Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=carB PE=3 SV=1 452 1500 0.0E+00
sp|O27077|CARB_METTH Carbamoyl-phosphate synthase large chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carB PE=3 SV=2 451 1498 0.0E+00
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B1I4M8|CARB_DESAP Carbamoyl-phosphate synthase large chain OS=Desulforudis audaxviator (strain MP104C) GN=carB PE=3 SV=1 451 1498 0.0E+00
sp|P25994|CARB_BACSU Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus subtilis (strain 168) GN=pyrAB PE=3 SV=1 449 1500 0.0E+00
sp|Q8RBK0|CARB_CALS4 Carbamoyl-phosphate synthase large chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carB PE=3 SV=1 452 1500 0.0E+00
sp|C3NEM0|CARB_SULIY Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=carB PE=3 SV=1 453 1487 0.0E+00
sp|C3MQE3|CARB_SULIL Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=carB PE=3 SV=1 453 1487 0.0E+00
sp|C3MW21|CARB_SULIM Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=carB PE=3 SV=1 453 1487 0.0E+00
sp|C3N664|CARB_SULIA Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.27) GN=carB PE=3 SV=1 453 1487 0.0E+00
sp|C4KHM7|CARB_SULIK Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=carB PE=3 SV=1 453 1487 0.0E+00
sp|C3NH23|CARB_SULIN Carbamoyl-phosphate synthase large chain OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=carB PE=3 SV=1 453 1487 0.0E+00
sp|Q8CPJ4|CARB_STAES Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A8YVZ3|CARB_LACH4 Carbamoyl-phosphate synthase large chain OS=Lactobacillus helveticus (strain DPC 4571) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A5UKG5|CARB_METS3 Carbamoyl-phosphate synthase large chain OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=carB PE=3 SV=1 452 1498 0.0E+00
sp|Q5HPY8|CARB_STAEQ Carbamoyl-phosphate synthase large chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|P46537|CARB_BACCL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus caldolyticus GN=pyrAB PE=3 SV=1 449 1498 0.0E+00
sp|Q047M8|CARB_LACDB Carbamoyl-phosphate synthase large chain OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q5FJC0|CARB_LACAC Carbamoyl-phosphate synthase large chain OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q59969|CARB_SULSO Carbamoyl-phosphate synthase large chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carB PE=3 SV=1 449 1487 0.0E+00
sp|A0B8K9|CARB_METTP Carbamoyl-phosphate synthase large chain OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=carB PE=3 SV=1 449 1489 0.0E+00
sp|B9DPN2|CARB_STACT Carbamoyl-phosphate synthase large chain OS=Staphylococcus carnosus (strain TM300) GN=carB PE=3 SV=1 452 1498 0.0E+00
sp|A7GRL1|CARB_BACCN Carbamoyl-phosphate synthase large chain OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|O50302|CARB_GEOSE Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Geobacillus stearothermophilus GN=pyrAB PE=3 SV=1 449 1498 0.0E+00
sp|A5D508|CARB_PELTS Carbamoyl-phosphate synthase large chain OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=carB PE=3 SV=1 449 1494 0.0E+00
sp|Q3K150|CARB_STRA1 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q49WY4|CARB_STAS1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q8E5F5|CARB_STRA3 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q74J34|CARB_LACJO Carbamoyl-phosphate synthase large chain OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q732I3|CARB_BACC1 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B7IUP6|CARB_BACC2 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain G9842) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q8DZQ7|CARB_STRA5 Carbamoyl-phosphate synthase large chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B3WEF5|CARB_LACCB Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain BL23) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q6HES8|CARB_BACHK Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A9VTC6|CARB_BACWK Carbamoyl-phosphate synthase large chain OS=Bacillus weihenstephanensis (strain KBAB4) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q636E0|CARB_BACCZ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ZK / E33L) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B2GD06|CARB_LACF3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B9IVW3|CARB_BACCQ Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain Q1) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B7HLM0|CARB_BACC7 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH187) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q03LT8|CARB_STRTD Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q5M5F6|CARB_STRT2 Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q5M0W9|CARB_STRT1 Carbamoyl-phosphate synthase large chain OS=Streptococcus thermophilus (strain CNRZ 1066) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B7JJX3|CARB_BACC0 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain AH820) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q4L5Q5|CARB_STAHJ Carbamoyl-phosphate synthase large chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|P63740|CARB_STAAN Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain N315) GN=carB PE=1 SV=1 449 1503 0.0E+00
sp|P63739|CARB_STAAM Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A5IS88|CARB_STAA9 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH9) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A6U122|CARB_STAA2 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain JH1) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A7X1F4|CARB_STAA1 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A8Z3P0|CARB_STAAT Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q6GA10|CARB_STAAS Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MSSA476) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A6QGA4|CARB_STAAE Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain Newman) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q5HGM9|CARB_STAAC Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain COL) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q2FZ72|CARB_STAA8 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain NCTC 8325) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q2FHN5|CARB_STAA3 Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain USA300) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q038Z2|CARB_LACC3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus casei (strain ATCC 334) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q819S3|CARB_BACCR Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B8D1H3|CARB_HALOH Carbamoyl-phosphate synthase large chain OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=carB PE=3 SV=1 451 1500 0.0E+00
sp|Q81WF2|CARB_BACAN Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|C3L740|CARB_BACAC Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|C3P656|CARB_BACAA Carbamoyl-phosphate synthase large chain OS=Bacillus anthracis (strain A0248) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B7H6M2|CARB_BACC4 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain B4264) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B1YIR9|CARB_EXIS2 Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q2YXG5|CARB_STAAB Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|C1EPQ0|CARB_BACC3 Carbamoyl-phosphate synthase large chain OS=Bacillus cereus (strain 03BB102) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A0RHQ8|CARB_BACAH Carbamoyl-phosphate synthase large chain OS=Bacillus thuringiensis (strain Al Hakam) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q38X24|CARB_LACSS Carbamoyl-phosphate synthase large chain OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|Q834E2|CARB_ENTFA Carbamoyl-phosphate synthase large chain OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q6GHN2|CARB_STAAR Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MRSA252) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q0SPY4|CARB_CLOPS Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain SM101 / Type A) GN=carB PE=3 SV=1 452 1496 0.0E+00
sp|A3CNI5|CARB_STRSV Carbamoyl-phosphate synthase large chain OS=Streptococcus sanguinis (strain SK36) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A7GE89|CARB_CLOBL Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=carB PE=3 SV=1 452 1496 0.0E+00
sp|Q8XHB3|CARB_CLOPE Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain 13 / Type A) GN=carB PE=3 SV=1 452 1496 0.0E+00
sp|B1HQC1|CARB_LYSSC Carbamoyl-phosphate synthase large chain OS=Lysinibacillus sphaericus (strain C3-41) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 452 1498 0.0E+00
sp|Q0TM79|CARB_CLOP1 Carbamoyl-phosphate synthase large chain OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=carB PE=3 SV=1 452 1496 0.0E+00
sp|Q8DUP3|CARB_STRMU Carbamoyl-phosphate synthase large chain OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|C1FNY3|CARB_CLOBJ Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Kyoto / Type A2) GN=carB PE=3 SV=1 452 1496 0.0E+00
sp|A9KI94|CARB_CLOPH Carbamoyl-phosphate synthase large chain OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=carB PE=3 SV=1 451 1498 0.0E+00
sp|A8AX83|CARB_STRGC Carbamoyl-phosphate synthase large chain OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B2THH3|CARB_CLOBB Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=carB PE=3 SV=1 452 1486 0.0E+00
sp|Q9K9V9|CARB_BACHD Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAB PE=3 SV=1 449 1498 0.0E+00
sp|B2A170|CARB_NATTJ Carbamoyl-phosphate synthase large chain OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B1KT07|CARB_CLOBM Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=carB PE=3 SV=1 452 1502 0.0E+00
sp|C1A4I5|CARB_GEMAT Carbamoyl-phosphate synthase large chain OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=carB PE=3 SV=1 449 1439 0.0E+00
sp|C1CEM9|CARB_STRZJ Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain JJA) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|B5E512|CARB_STRP4 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|Q67Q54|CARB_SYMTH Carbamoyl-phosphate synthase large chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carB PE=3 SV=1 449 1499 0.0E+00
sp|B1IC65|CARB_STRPI Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|B2UX86|CARB_CLOBA Carbamoyl-phosphate synthase large chain OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=carB PE=3 SV=1 452 1486 0.0E+00
sp|Q03WW7|CARB_LEUMM Carbamoyl-phosphate synthase large chain OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|P58940|CARB_STAAW Carbamoyl-phosphate synthase large chain OS=Staphylococcus aureus (strain MW2) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|C1CL09|CARB_STRZP Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain P1031) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|B2IQ67|CARB_STRPS Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain CGSP14) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|B8ZJT9|CARB_STRPJ Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|C1CR31|CARB_STRZT Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|Q97QE4|CARB_STRPN Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|Q04K48|CARB_STRP2 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|C1C7Q3|CARB_STRP7 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain 70585) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|Q8CWR0|CARB_STRR6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=carB PE=3 SV=1 449 1504 0.0E+00
sp|O32771|CARB_LACLM Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=carB PE=2 SV=2 467 1488 0.0E+00
sp|A6LPD9|CARB_CLOB8 Carbamoyl-phosphate synthase large chain OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=carB PE=3 SV=1 452 1486 0.0E+00
sp|C4L5W3|CARB_EXISA Carbamoyl-phosphate synthase large chain OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q02YG5|CARB_LACLS Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=carB PE=3 SV=1 467 1488 0.0E+00
sp|B5XKW2|CARB_STRPZ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|C4ZEK2|CARB_EUBR3 Carbamoyl-phosphate synthase large chain OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=carB PE=3 SV=1 452 1498 0.0E+00
sp|Q8RG86|CARB_FUSNN Carbamoyl-phosphate synthase large chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carB PE=3 SV=2 449 1498 0.0E+00
sp|P0DA15|CARB_STRPQ Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|P77886|CARB_LACPL Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrAB PE=3 SV=2 449 1496 0.0E+00
sp|P0DA14|CARB_STRP3 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A2RF60|CARB_STRPG Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=carB PE=3 SV=1 446 1503 0.0E+00
sp|B2G564|CARB_LACRJ Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain JCM 1112) GN=carB PE=3 SV=1 449 1495 0.0E+00
sp|A5VHN6|CARB_LACRD Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain DSM 20016) GN=carB PE=3 SV=1 449 1495 0.0E+00
sp|P58943|CARB_XANCP Carbamoyl-phosphate synthase large chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q9A0C6|CARB_STRP1 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M1 GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q5XCR6|CARB_STRP6 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carB PE=3 SV=2 449 1503 0.0E+00
sp|Q9CFV2|CARB_LACLA Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=carB PE=3 SV=1 467 1503 0.0E+00
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|P58941|CARB_STRP8 Carbamoyl-phosphate synthase large chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|C0M756|CARB_STRE4 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. equi (strain 4047) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B9DRV7|CARB_STRU0 Carbamoyl-phosphate synthase large chain OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|Q03HB0|CARB_PEDPA Carbamoyl-phosphate synthase large chain OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|Q8F832|CARB_LEPIN Carbamoyl-phosphate synthase large chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q72NF1|CARB_LEPIC Carbamoyl-phosphate synthase large chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q1IPK2|CARB_KORVE Carbamoyl-phosphate synthase large chain OS=Koribacter versatilis (strain Ellin345) GN=carB PE=3 SV=1 449 1499 0.0E+00
sp|P58942|CARB_XANAC Carbamoyl-phosphate synthase large chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q55756|CARB_SYNY3 Carbamoyl-phosphate synthase large chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carB PE=3 SV=2 449 1498 0.0E+00
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|Q7MNU0|CARB_VIBVY Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain YJ016) GN=carB PE=3 SV=1 449 1424 0.0E+00
sp|Q8DEM2|CARB_VIBVU Carbamoyl-phosphate synthase large chain OS=Vibrio vulnificus (strain CMCP6) GN=carB PE=3 SV=1 449 1424 0.0E+00
sp|Q9KPH9|CARB_VIBCH Carbamoyl-phosphate synthase large chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=carB PE=3 SV=1 449 1424 0.0E+00
sp|Q87EB8|CARB_XYLFT Carbamoyl-phosphate synthase large chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q9CKV0|CARB_PASMU Carbamoyl-phosphate synthase large chain OS=Pasteurella multocida (strain Pm70) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|C0MEH1|CARB_STRS7 Carbamoyl-phosphate synthase large chain OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|A8F453|CARB_PSELT Carbamoyl-phosphate synthase large chain OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|Q87SF3|CARB_VIBPA Carbamoyl-phosphate synthase large chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=carB PE=3 SV=1 449 1424 0.0E+00
sp|Q8YQL2|CARB_NOSS1 Carbamoyl-phosphate synthase large chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carB PE=3 SV=1 449 1507 0.0E+00
sp|Q8ZY48|CARB_PYRAE Carbamoyl-phosphate synthase large chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=carB PE=3 SV=1 450 1379 0.0E+00
sp|Q87WP4|CARB_PSESM Carbamoyl-phosphate synthase large chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carB PE=3 SV=1 449 1508 0.0E+00
sp|B9KB91|CARB_THENN Carbamoyl-phosphate synthase large chain OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|B8H8U5|CARB_ARTCA Carbamoyl-phosphate synthase large chain OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|P38100|CARB_PSEAE Carbamoyl-phosphate synthase large chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=carB PE=3 SV=3 449 1508 0.0E+00
sp|Q9WZ27|CARB_THEMA Carbamoyl-phosphate synthase large chain OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 449 1424 0.0E+00
sp|A5IJL8|CARB_THEP1 Carbamoyl-phosphate synthase large chain OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|B1L8T8|CARB_THESQ Carbamoyl-phosphate synthase large chain OS=Thermotoga sp. (strain RQ2) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|A3CU73|CARB_METMJ Carbamoyl-phosphate synthase large chain OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=carB PE=3 SV=1 452 1489 0.0E+00
sp|A1R6Z3|CARB_ARTAT Carbamoyl-phosphate synthase large chain OS=Arthrobacter aurescens (strain TC1) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A0JX72|CARB_ARTS2 Carbamoyl-phosphate synthase large chain OS=Arthrobacter sp. (strain FB24) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B1MZ74|CARB_LEUCK Carbamoyl-phosphate synthase large chain OS=Leuconostoc citreum (strain KM20) GN=carB PE=3 SV=1 449 1486 0.0E+00
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 449 1424 0.0E+00
sp|Q8RSS3|CARB_HALER Carbamoyl-phosphate synthase large chain OS=Halomonas eurihalina GN=carB PE=3 SV=1 449 1508 0.0E+00
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 449 1424 0.0E+00
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 449 1424 0.0E+00
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 449 1424 0.0E+00
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 449 1424 0.0E+00
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 449 1424 0.0E+00
sp|C5CCF1|CARB_MICLC Carbamoyl-phosphate synthase large chain OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q6A914|CARB_PROAC Carbamoyl-phosphate synthase large chain OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q04H29|CARB_OENOB Carbamoyl-phosphate synthase large chain OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=carB PE=3 SV=1 449 1488 0.0E+00
sp|Q88DU6|CARB_PSEPK Carbamoyl-phosphate synthase large chain OS=Pseudomonas putida (strain KT2440) GN=carB PE=3 SV=2 449 1508 0.0E+00
sp|Q9PEC1|CARB_XYLFA Carbamoyl-phosphate synthase large chain OS=Xylella fastidiosa (strain 9a5c) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A2SQ53|CARB_METLZ Carbamoyl-phosphate synthase large chain OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=carB PE=3 SV=1 451 1498 0.0E+00
sp|A9WSA8|CARB_RENSM Carbamoyl-phosphate synthase large chain OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|P57244|CARB_BUCAI Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carB PE=3 SV=2 452 1438 0.0E+00
sp|Q9JXW8|CARB_NEIMB Carbamoyl-phosphate synthase large chain OS=Neisseria meningitidis serogroup B (strain MC58) GN=carB PE=3 SV=1 449 1506 0.0E+00
sp|B8GEA3|CARB_METPE Carbamoyl-phosphate synthase large chain OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=carB PE=3 SV=1 449 1502 0.0E+00
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 452 1438 0.0E+00
sp|Q9JW02|CARB_NEIMA Carbamoyl-phosphate synthase large chain OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=carB PE=3 SV=1 449 1506 0.0E+00
sp|Q42601|CARB_ARATH Carbamoyl-phosphate synthase large chain, chloroplastic OS=Arabidopsis thaliana GN=CARB PE=1 SV=1 449 1498 0.0E+00
sp|Q8FT42|CARB_COREF Carbamoyl-phosphate synthase large chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|C1F1S6|CARB_ACIC5 Carbamoyl-phosphate synthase large chain OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=carB PE=3 SV=1 449 1422 0.0E+00
sp|A6WCC6|CARB_KINRD Carbamoyl-phosphate synthase large chain OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|A7I6J1|CARB_METB6 Carbamoyl-phosphate synthase large chain OS=Methanoregula boonei (strain 6A8) GN=carB PE=3 SV=1 449 1489 0.0E+00
sp|Q7VP67|CARB_HAEDU Carbamoyl-phosphate synthase large chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=carB PE=3 SV=1 467 1502 0.0E+00
sp|Q2FLD9|CARB_METHJ Carbamoyl-phosphate synthase large chain OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=carB PE=3 SV=1 451 1489 0.0E+00
sp|P58939|CARB_CORGL Carbamoyl-phosphate synthase large chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B2GI87|CARB_KOCRD Carbamoyl-phosphate synthase large chain OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|B1W463|CARB_STRGG Carbamoyl-phosphate synthase large chain OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|Q1AVY9|CARB_RUBXD Carbamoyl-phosphate synthase large chain OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=carB PE=3 SV=1 449 1483 0.0E+00
sp|B9EXM2|CARB_ORYSJ Carbamoyl-phosphate synthase large chain, chloroplastic OS=Oryza sativa subsp. japonica GN=CARB PE=2 SV=1 421 1498 0.0E+00
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 449 1506 0.0E+00
sp|Q827Q7|CARB_STRAW Carbamoyl-phosphate synthase large chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carB PE=3 SV=1 449 1509 0.0E+00
sp|Q9KXR6|CARB_STRCO Carbamoyl-phosphate synthase large chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carB PE=3 SV=1 449 1509 0.0E+00
sp|P59448|CARB_BUCBP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carB PE=3 SV=1 449 1424 0.0E+00
sp|B0REV9|CARB_CLAMS Carbamoyl-phosphate synthase large chain OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=carB PE=3 SV=1 449 1488 0.0E+00
sp|Q7UJ58|CARB_RHOBA Carbamoyl-phosphate synthase large chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carB PE=3 SV=1 449 1488 0.0E+00
sp|Q59599|CARB_NEIGO Carbamoyl-phosphate synthase large chain OS=Neisseria gonorrhoeae GN=carB PE=3 SV=2 449 1506 0.0E+00
sp|Q8XZ83|CARB_RALSO Carbamoyl-phosphate synthase large chain OS=Ralstonia solanacearum (strain GMI1000) GN=carB PE=3 SV=1 467 1424 0.0E+00
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 449 1506 0.0E+00
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 449 1506 0.0E+00
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 449 1506 0.0E+00
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 449 1509 0.0E+00
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 449 1509 0.0E+00
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus subtilis (strain 168) GN=carB PE=3 SV=4 451 1363 0.0E+00
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 449 1509 0.0E+00
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 449 1509 0.0E+00
sp|A5CRX5|CARB_CLAM3 Carbamoyl-phosphate synthase large chain OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=carB PE=3 SV=1 449 1488 0.0E+00
sp|C1CXR4|CARB_DEIDV Carbamoyl-phosphate synthase large chain OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=carB PE=3 SV=1 449 1387 0.0E+00
sp|Q8G815|CARB_BIFLO Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum (strain NCC 2705) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B3DQ32|CARB_BIFLD Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum (strain DJO10A) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|B7GPW2|CARB_BIFLS Carbamoyl-phosphate synthase large chain OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|C5C687|CARB_BEUC1 Carbamoyl-phosphate synthase large chain OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=carB PE=3 SV=1 449 1500 0.0E+00
sp|A1A0T4|CARB_BIFAA Carbamoyl-phosphate synthase large chain OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=carB PE=3 SV=1 449 1498 0.0E+00
sp|O50236|CARB_ZYMMO Carbamoyl-phosphate synthase large chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=carB PE=3 SV=2 449 1422 0.0E+00
sp|Q9RWK0|CARB_DEIRA Carbamoyl-phosphate synthase large chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=carB PE=3 SV=1 449 1387 0.0E+00
sp|Q9K8V7|CARY_BACHD Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carB PE=3 SV=1 449 1404 0.0E+00
sp|Q1IWM0|CARB_DEIGD Carbamoyl-phosphate synthase large chain OS=Deinococcus geothermalis (strain DSM 11300) GN=carB PE=3 SV=1 449 1386 0.0E+00
sp|Q9PIL7|CARB_CAMJE Carbamoyl-phosphate synthase large chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=carB PE=3 SV=1 449 1507 0.0E+00
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 449 1509 0.0E+00
sp|B8DTW3|CARB_BIFA0 Carbamoyl-phosphate synthase large chain OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=carB PE=3 SV=1 449 1503 0.0E+00
sp|Q9ZB63|CARY_GEOSE Carbamoyl-phosphate synthase arginine-specific large chain OS=Geobacillus stearothermophilus GN=carB PE=1 SV=1 451 1397 0.0E+00
sp|Q98I87|CARB_RHILO Carbamoyl-phosphate synthase large chain OS=Rhizobium loti (strain MAFF303099) GN=carB PE=3 SV=1 449 1419 0.0E+00
sp|Q5SKN1|CARB_THET8 Carbamoyl-phosphate synthase large chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=carB PE=3 SV=1 446 1383 0.0E+00
sp|Q9A4D6|CARB_CAUCR Carbamoyl-phosphate synthase large chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=carB PE=3 SV=1 449 1473 0.0E+00
sp|P96495|CARB_THET2 Carbamoyl-phosphate synthase large chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=carB PE=3 SV=2 446 1383 0.0E+00
sp|Q8UDE9|CARB_AGRFC Carbamoyl-phosphate synthase large chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=carB PE=3 SV=2 449 1488 0.0E+00
sp|Q8YIC2|CARB_BRUME Carbamoyl-phosphate synthase large chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=carB PE=3 SV=1 449 1469 0.0E+00
sp|Q92PZ4|CARB_RHIME Carbamoyl-phosphate synthase large chain OS=Rhizobium meliloti (strain 1021) GN=carB PE=3 SV=1 449 1469 0.0E+00
sp|Q9ZKT2|CARB_HELPJ Carbamoyl-phosphate synthase large chain OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=carB PE=3 SV=1 449 1449 0.0E+00
sp|O25577|CARB_HELPY Carbamoyl-phosphate synthase large chain OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=carB PE=3 SV=1 449 1449 0.0E+00
sp|Q8FZJ3|CARB_BRUSU Carbamoyl-phosphate synthase large chain OS=Brucella suis biovar 1 (strain 1330) GN=carB PE=3 SV=1 449 1469 0.0E+00
sp|Q9HP43|CARB_HALSA Carbamoyl-phosphate synthase large chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=carB PE=3 SV=1 453 1367 0.0E+00
sp|Q97AJ3|CARB_THEVO Carbamoyl-phosphate synthase large chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=carB PE=3 SV=1 449 1491 0.0E+00
sp|Q9HK17|CARB_THEAC Carbamoyl-phosphate synthase large chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=carB PE=3 SV=1 449 1507 0.0E+00
sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carB PE=2 SV=3 451 1365 0.0E+00
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 449 989 5.0E-165
sp|Q8TWX0|CARB1_METKA Carbamoyl-phosphate synthase large chain, N-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB1 PE=3 SV=1 453 992 7.0E-157
sp|Q58773|CARB1_METJA Carbamoyl-phosphate synthase large chain, N-terminal section OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carB1 PE=3 SV=2 451 905 1.0E-155
sp|Q58776|CARB2_METJA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carB2 PE=3 SV=1 916 1498 5.0E-132
sp|Q8TUT7|CARB2_METKA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB2 PE=3 SV=1 996 1487 5.0E-115
sp|P07258|CARA_YEAST Carbamoyl-phosphate synthase arginine-specific small chain OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPA1 PE=1 SV=1 13 419 5.0E-113
sp|Q5AML6|CARA_CANAL Carbamoyl-phosphate synthase arginine-specific small chain OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPA1 PE=3 SV=1 20 433 8.0E-109
sp|Q752N9|CARA_ASHGO Carbamoyl-phosphate synthase arginine-specific small chain OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CPA1 PE=3 SV=1 26 417 7.0E-108
sp|P22572|CARA_NEUCR Carbamoyl-phosphate synthase arginine-specific small chain, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arg-2 PE=3 SV=2 26 435 5.0E-107
sp|O67233|CARB2_AQUAE Carbamoyl-phosphate synthase large chain, C-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB2 PE=3 SV=1 996 1498 2.0E-106
sp|Q2H132|CARA_CHAGB Carbamoyl-phosphate synthase arginine-specific small chain OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CPA1 PE=3 SV=1 5 419 8.0E-106
sp|Q1DUF5|CARA_COCIM Carbamoyl-phosphate synthase arginine-specific small chain OS=Coccidioides immitis (strain RS) GN=CPA1 PE=3 SV=1 24 419 9.0E-106
sp|Q5BB37|CARA_EMENI Carbamoyl-phosphate synthase arginine-specific small chain OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpa-1 PE=2 SV=2 4 419 2.0E-105
sp|A1CZ92|CARA_NEOFI Carbamoyl-phosphate synthase arginine-specific small chain OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cpa1 PE=3 SV=1 24 419 2.0E-104
sp|Q6C9Y4|CARA_YARLI Carbamoyl-phosphate synthase arginine-specific small chain OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CPA1 PE=3 SV=1 24 432 3.0E-104
sp|A1CA18|CARA_ASPCL Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cpa1 PE=3 SV=1 13 419 6.0E-104
sp|A2R9B9|CARA_ASPNC Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cpa1 PE=3 SV=1 24 420 8.0E-104
sp|Q2U913|CARA_ASPOR Carbamoyl-phosphate synthase arginine-specific small chain OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpa1 PE=3 SV=1 24 419 1.0E-103
sp|Q6BJG4|CARA_DEBHA Carbamoyl-phosphate synthase arginine-specific small chain OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CPA1 PE=3 SV=1 24 419 2.0E-103
sp|Q4WU09|CARA_ASPFU Carbamoyl-phosphate synthase arginine-specific small chain OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpa1 PE=3 SV=1 24 419 3.0E-103
sp|Q6FQ30|CARA_CANGA Carbamoyl-phosphate synthase arginine-specific small chain OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CPA1 PE=3 SV=1 24 419 4.0E-103
sp|O60060|CARA_SCHPO Carbamoyl-phosphate synthase arginine-specific small chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arg5 PE=3 SV=1 21 420 5.0E-103
sp|Q0U5H7|CARA_PHANO Carbamoyl-phosphate synthase arginine-specific small chain OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPA1 PE=3 SV=1 24 419 1.0E-100
sp|P87183|CARA_HYPVI Carbamoyl-phosphate synthase arginine-specific small chain OS=Hypocrea virens GN=cpa1 PE=3 SV=1 24 422 3.0E-100
sp|Q6CIQ1|CARA_KLULA Carbamoyl-phosphate synthase arginine-specific small chain OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CPA1 PE=3 SV=1 32 417 5.0E-99
sp|Q8U086|CARA_PYRFU Carbamoyl-phosphate synthase small chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carA PE=3 SV=1 24 416 2.0E-84
sp|Q8RG87|CARA_FUSNN Carbamoyl-phosphate synthase small chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carA PE=3 SV=1 24 419 4.0E-76
sp|O28995|CARA_ARCFU Carbamoyl-phosphate synthase small chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carA PE=3 SV=1 24 419 2.0E-75
sp|P52557|CARA_BACCL Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Bacillus caldolyticus GN=pyrAA PE=3 SV=1 24 416 7.0E-75
sp|Q9RWI4|CARA_DEIRA Carbamoyl-phosphate synthase small chain OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=carA PE=3 SV=1 23 421 7.0E-75
sp|B2URJ0|CARA_AKKM8 Carbamoyl-phosphate synthase small chain OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=carA PE=3 SV=1 24 427 1.0E-74
sp|Q1IWN0|CARA_DEIGD Carbamoyl-phosphate synthase small chain OS=Deinococcus geothermalis (strain DSM 11300) GN=carA PE=3 SV=1 23 421 1.0E-74
sp|Q67Q55|CARA_SYMTH Carbamoyl-phosphate synthase small chain OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=carA PE=3 SV=1 26 419 3.0E-74
sp|Q8XHB2|CARA_CLOPE Carbamoyl-phosphate synthase small chain OS=Clostridium perfringens (strain 13 / Type A) GN=carA PE=3 SV=1 24 416 8.0E-74
sp|P0DA13|CARA_STRPQ Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=carA PE=3 SV=1 24 419 1.0E-73
sp|Q5XCR8|CARA_STRP6 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=carA PE=3 SV=1 24 419 1.0E-73
sp|P0DA12|CARA_STRP3 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=carA PE=3 SV=1 24 419 1.0E-73
sp|P63735|CARA_STRP1 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M1 GN=carA PE=3 SV=1 24 419 1.0E-73
sp|P58894|CARA_STRP8 Carbamoyl-phosphate synthase small chain OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=carA PE=3 SV=1 24 419 1.0E-73
sp|P13258|CARB_METBA Carbamoyl-phosphate synthase large chain (Fragment) OS=Methanosarcina barkeri GN=carB PE=3 SV=1 1118 1489 5.0E-73
sp|Q58425|CARA_METJA Carbamoyl-phosphate synthase small chain OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carA PE=3 SV=2 24 416 6.0E-73
sp|Q9K9V8|CARA_BACHD Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAA PE=3 SV=1 24 416 6.0E-73
sp|Q8RBK1|CARA_CALS4 Carbamoyl-phosphate synthase small chain OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=carA PE=3 SV=1 24 424 7.0E-73
sp|O66727|CARA_AQUAE Carbamoyl-phosphate synthase small chain OS=Aquifex aeolicus (strain VF5) GN=carA PE=3 SV=1 23 416 1.0E-72
sp|Q8TY15|CARA_METKA Carbamoyl-phosphate synthase small chain OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carA PE=3 SV=1 23 416 1.0E-72
sp|Q732I2|CARA_BACC1 Carbamoyl-phosphate synthase small chain OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=carA PE=3 SV=1 24 419 2.0E-72
sp|O27079|CARA_METTH Carbamoyl-phosphate synthase small chain OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=carA PE=3 SV=2 24 413 2.0E-72
sp|Q6HES7|CARA_BACHK Carbamoyl-phosphate synthase small chain OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=carA PE=3 SV=1 24 419 2.0E-72
sp|Q81WF1|CARA_BACAN Carbamoyl-phosphate synthase small chain OS=Bacillus anthracis GN=carA PE=3 SV=1 24 419 2.0E-72
sp|Q819S2|CARA_BACCR Carbamoyl-phosphate synthase small chain OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=carA PE=3 SV=2 24 419 2.0E-72
sp|A4YI77|CARA_METS5 Carbamoyl-phosphate synthase small chain OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=carA PE=3 SV=1 19 420 2.0E-72
sp|Q8YXQ7|CARA_NOSS1 Carbamoyl-phosphate synthase small chain OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=carA PE=3 SV=1 24 416 3.0E-72
sp|Q8DUP4|CARA_STRMU Carbamoyl-phosphate synthase small chain OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=carA PE=3 SV=1 20 427 3.0E-72
sp|Q636D9|CARA_BACCZ Carbamoyl-phosphate synthase small chain OS=Bacillus cereus (strain ZK / E33L) GN=carA PE=3 SV=1 24 419 3.0E-72
sp|P25993|CARA_BACSU Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Bacillus subtilis (strain 168) GN=pyrAA PE=3 SV=1 24 425 3.0E-71
sp|Q8CXH8|CARA_OCEIH Carbamoyl-phosphate synthase small chain OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=carA PE=3 SV=1 24 421 7.0E-71
sp|Q8Q0U4|CARA_METMA Carbamoyl-phosphate synthase small chain OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=carA PE=3 SV=1 24 412 1.0E-70
sp|Q6GHN3|CARA_STAAR Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MRSA252) GN=carA PE=3 SV=1 24 416 3.0E-70
sp|P63730|CARA_STAAW Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MW2) GN=carA PE=3 SV=1 24 416 3.0E-70
sp|Q6GA11|CARA_STAAS Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain MSSA476) GN=carA PE=3 SV=1 24 416 3.0E-70
sp|P99147|CARA_STAAN Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain N315) GN=carA PE=1 SV=1 24 416 3.0E-70
sp|P63729|CARA_STAAM Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=carA PE=3 SV=1 24 416 3.0E-70
sp|Q5HGN0|CARA_STAAC Carbamoyl-phosphate synthase small chain OS=Staphylococcus aureus (strain COL) GN=carA PE=3 SV=1 24 416 3.0E-70
sp|Q8TNY3|CARA_METAC Carbamoyl-phosphate synthase small chain OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=carA PE=3 SV=1 24 412 1.0E-69
sp|P63734|CARA_STRR6 Carbamoyl-phosphate synthase small chain OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=carA PE=3 SV=1 24 419 2.0E-69
sp|P63733|CARA_STRPN Carbamoyl-phosphate synthase small chain OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=carA PE=3 SV=1 24 419 2.0E-69
sp|Q8Y664|CARA_LISMO Carbamoyl-phosphate synthase small chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carA PE=3 SV=1 23 419 2.0E-69
sp|Q5SLL3|CARA_THET8 Carbamoyl-phosphate synthase small chain OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=carA PE=3 SV=1 13 421 3.0E-69
sp|Q72GZ0|CARA_THET2 Carbamoyl-phosphate synthase small chain OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=carA PE=3 SV=1 13 421 3.0E-69
sp|Q71YI0|CARA_LISMF Carbamoyl-phosphate synthase small chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carA PE=3 SV=1 23 419 5.0E-69
sp|Q72PK5|CARA_LEPIC Carbamoyl-phosphate synthase small chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=carA PE=3 SV=1 24 424 6.0E-69
sp|Q9L4N5|CARA_LACLM Carbamoyl-phosphate synthase small chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=carA PE=3 SV=1 24 417 1.0E-68
sp|A4SXM1|CARA_POLSQ Carbamoyl-phosphate synthase small chain OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=carA PE=3 SV=1 21 425 1.0E-68
sp|Q9K8V6|CARX_BACHD Carbamoyl-phosphate synthase arginine-specific small chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carA PE=3 SV=1 24 425 1.0E-68
sp|Q8CPJ5|CARA_STAES Carbamoyl-phosphate synthase small chain OS=Staphylococcus epidermidis (strain ATCC 12228) GN=carA PE=3 SV=1 24 416 1.0E-68
sp|Q3A450|CARA_PELCD Carbamoyl-phosphate synthase small chain OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=carA PE=3 SV=1 24 417 1.0E-68
sp|Q4J8E9|CARA_SULAC Carbamoyl-phosphate synthase small chain OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=carA PE=3 SV=1 26 423 1.0E-68
sp|Q8F6R2|CARA_LEPIN Carbamoyl-phosphate synthase small chain OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=carA PE=3 SV=2 24 424 2.0E-68
sp|Q8KZA0|CARA_DESVM Carbamoyl-phosphate synthase small chain OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=carA PE=3 SV=1 24 415 2.0E-68
sp|Q31LB7|CARA_SYNE7 Carbamoyl-phosphate synthase small chain OS=Synechococcus elongatus (strain PCC 7942) GN=carA PE=3 SV=1 15 416 3.0E-68
sp|Q9CF80|CARA_LACLA Carbamoyl-phosphate synthase small chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=carA PE=3 SV=1 24 417 4.0E-68
sp|Q8DKU5|CARA_THEEB Carbamoyl-phosphate synthase small chain OS=Thermosynechococcus elongatus (strain BP-1) GN=carA PE=3 SV=1 24 416 5.0E-68
sp|Q5HPY9|CARA_STAEQ Carbamoyl-phosphate synthase small chain OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=carA PE=3 SV=1 24 416 5.0E-68
sp|Q49WY3|CARA_STAS1 Carbamoyl-phosphate synthase small chain OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=carA PE=3 SV=1 24 419 7.0E-68
sp|Q970U8|CARA_SULTO Carbamoyl-phosphate synthase small chain OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=carA PE=3 SV=1 24 419 7.0E-68
sp|Q5LTN6|CARA_RUEPO Carbamoyl-phosphate synthase small chain OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=carA PE=3 SV=1 23 421 9.0E-68
sp|Q92AH2|CARA_LISIN Carbamoyl-phosphate synthase small chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carA PE=3 SV=1 23 419 9.0E-68
sp|Q5N0L0|CARA_SYNP6 Carbamoyl-phosphate synthase small chain OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=carA PE=3 SV=1 15 416 1.0E-67
sp|Q6LWW5|CARA_METMP Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain S2 / LL) GN=carA PE=3 SV=1 24 417 2.0E-67
sp|Q04ZG6|CARA_LEPBL Carbamoyl-phosphate synthase small chain OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=carA PE=3 SV=1 24 424 2.0E-67
sp|Q04R57|CARA_LEPBJ Carbamoyl-phosphate synthase small chain OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=carA PE=3 SV=1 24 424 2.0E-67
sp|Q4L5Q4|CARA_STAHJ Carbamoyl-phosphate synthase small chain OS=Staphylococcus haemolyticus (strain JCSC1435) GN=carA PE=3 SV=1 24 416 5.0E-67
sp|Q59968|CARA_SULSO Carbamoyl-phosphate synthase small chain OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=carA PE=3 SV=1 24 415 8.0E-67
sp|P63732|CARA_STRA5 Carbamoyl-phosphate synthase small chain OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=carA PE=3 SV=1 24 419 8.0E-67
sp|P63731|CARA_STRA3 Carbamoyl-phosphate synthase small chain OS=Streptococcus agalactiae serotype III (strain NEM316) GN=carA PE=3 SV=1 24 419 8.0E-67
sp|A4G0Y3|CARA_METM5 Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=carA PE=3 SV=1 24 417 1.0E-66
sp|C6C0A9|CARA_DESAD Carbamoyl-phosphate synthase small chain OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=carA PE=3 SV=1 24 419 1.0E-66
sp|Q7UGJ6|CARA_RHOBA Carbamoyl-phosphate synthase small chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carA PE=3 SV=1 24 415 2.0E-66
sp|P74587|CARA_SYNY3 Carbamoyl-phosphate synthase small chain OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=carA PE=3 SV=2 6 416 4.0E-66
sp|A6VHH7|CARA_METM7 Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=carA PE=3 SV=1 24 417 9.0E-66
sp|B4S5S1|CARA_PROA2 Carbamoyl-phosphate synthase small chain OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=carA PE=3 SV=1 24 416 1.0E-65
sp|A6WZJ5|CARA_OCHA4 Carbamoyl-phosphate synthase small chain OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=carA PE=3 SV=1 23 419 1.0E-65
sp|Q8ZY49|CARA_PYRAE Carbamoyl-phosphate synthase small chain OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=carA PE=3 SV=1 26 419 1.0E-65
sp|A1VA26|CARA_DESVV Carbamoyl-phosphate synthase small chain OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=carA PE=3 SV=1 24 419 2.0E-65
sp|Q726J4|CARA_DESVH Carbamoyl-phosphate synthase small chain OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=carA PE=3 SV=1 24 419 2.0E-65
sp|P77885|CARA_LACPL Carbamoyl-phosphate synthase pyrimidine-specific small chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrAA PE=3 SV=2 24 421 2.0E-65
sp|A9A972|CARA_METM6 Carbamoyl-phosphate synthase small chain OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=carA PE=3 SV=1 24 417 2.0E-65
sp|B1XUM3|CARA_POLNS Carbamoyl-phosphate synthase small chain OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=carA PE=3 SV=1 24 424 2.0E-65
sp|A6UQN4|CARA_METVS Carbamoyl-phosphate synthase small chain OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=carA PE=3 SV=1 24 416 4.0E-65
sp|Q97FT2|CARA_CLOAB Carbamoyl-phosphate synthase small chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carA PE=3 SV=1 26 417 1.0E-64
sp|Q8KGA2|CARA_CHLTE Carbamoyl-phosphate synthase small chain OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=carA PE=3 SV=1 24 417 2.0E-64
sp|C4XRH8|CARA_DESMR Carbamoyl-phosphate synthase small chain OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=carA PE=3 SV=1 24 419 4.0E-64
sp|P54324|CARX_GEOSE Carbamoyl-phosphate synthase arginine-specific small chain OS=Geobacillus stearothermophilus GN=carA PE=1 SV=1 40 419 4.0E-64
sp|Q98IA7|CARA_RHILO Carbamoyl-phosphate synthase small chain OS=Rhizobium loti (strain MAFF303099) GN=carA PE=3 SV=1 24 419 5.0E-64
sp|A1UTE8|CARA_BARBK Carbamoyl-phosphate synthase small chain OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=carA PE=3 SV=1 24 420 6.0E-64
sp|Q8UDF7|CARA_AGRFC Carbamoyl-phosphate synthase small chain OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=carA PE=3 SV=2 24 431 6.0E-64
sp|P14845|CARA_SALTY Carbamoyl-phosphate synthase small chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carA PE=3 SV=2 24 419 1.0E-63
sp|Q6YV23|CARA_ORYSJ Carbamoyl-phosphate synthase small chain, chloroplastic OS=Oryza sativa subsp. japonica GN=CARA PE=2 SV=2 24 419 3.0E-63
sp|Q7U7F9|CARA_SYNPX Carbamoyl-phosphate synthase small chain OS=Synechococcus sp. (strain WH8102) GN=carA PE=3 SV=1 24 425 3.0E-63
sp|Q6FZ66|CARA_BARQU Carbamoyl-phosphate synthase small chain OS=Bartonella quintana (strain Toulouse) GN=carA PE=3 SV=1 24 424 5.0E-63
sp|Q8FZJ8|CARA_BRUSU Carbamoyl-phosphate synthase small chain OS=Brucella suis biovar 1 (strain 1330) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|A9M6F1|CARA_BRUC2 Carbamoyl-phosphate synthase small chain OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|B0CHS0|CARA_BRUSI Carbamoyl-phosphate synthase small chain OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|A5VRM1|CARA_BRUO2 Carbamoyl-phosphate synthase small chain OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|Q8YIB8|CARA_BRUME Carbamoyl-phosphate synthase small chain OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=carA PE=3 SV=2 23 419 6.0E-63
sp|C0REC2|CARA_BRUMB Carbamoyl-phosphate synthase small chain OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|Q57C28|CARA_BRUAB Carbamoyl-phosphate synthase small chain OS=Brucella abortus biovar 1 (strain 9-941) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|Q2YM22|CARA_BRUA2 Carbamoyl-phosphate synthase small chain OS=Brucella abortus (strain 2308) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|B2S6U9|CARA_BRUA1 Carbamoyl-phosphate synthase small chain OS=Brucella abortus (strain S19) GN=carA PE=3 SV=1 23 419 6.0E-63
sp|Q8Z9L8|CARA_SALTI Carbamoyl-phosphate synthase small chain OS=Salmonella typhi GN=carA PE=3 SV=1 24 419 7.0E-63
sp|P58896|CARA_XANCP Carbamoyl-phosphate synthase small chain OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=carA PE=3 SV=1 24 416 1.0E-62
sp|Q8FLB1|CARA_ECOL6 Carbamoyl-phosphate synthase small chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carA PE=3 SV=2 24 416 1.0E-62
sp|Q92N95|CARA_RHIME Carbamoyl-phosphate synthase small chain OS=Rhizobium meliloti (strain 1021) GN=carA PE=3 SV=1 24 431 2.0E-62
sp|Q8XZ85|CARA_RALSO Carbamoyl-phosphate synthase small chain OS=Ralstonia solanacearum (strain GMI1000) GN=carA PE=3 SV=1 24 419 2.0E-62
sp|Q8TUT7|CARB2_METKA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB2 PE=3 SV=1 454 859 3.0E-62
sp|Q87WP3|CARA_PSESM Carbamoyl-phosphate synthase small chain OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=carA PE=3 SV=1 24 419 3.0E-62
sp|Q8RSS4|CARA_HALER Carbamoyl-phosphate synthase small chain OS=Halomonas eurihalina GN=carA PE=3 SV=2 24 417 4.0E-62
sp|P0A6F1|CARA_ECOLI Carbamoyl-phosphate synthase small chain OS=Escherichia coli (strain K12) GN=carA PE=1 SV=1 24 419 5.0E-62
sp|P0A6F2|CARA_ECO57 Carbamoyl-phosphate synthase small chain OS=Escherichia coli O157:H7 GN=carA PE=3 SV=1 24 419 5.0E-62
sp|Q9JP87|CARA_RUBGI Carbamoyl-phosphate synthase small chain OS=Rubrivivax gelatinosus (strain NBRC 100245 / IL144) GN=carA PE=3 SV=1 24 416 5.0E-62
sp|P51201|CARA_PORPU Carbamoyl-phosphate synthase small chain OS=Porphyra purpurea GN=carA PE=3 SV=1 24 419 5.0E-62
sp|A9IWF8|CARA_BART1 Carbamoyl-phosphate synthase small chain OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=carA PE=3 SV=1 24 420 9.0E-62
sp|P58895|CARA_XANAC Carbamoyl-phosphate synthase small chain OS=Xanthomonas axonopodis pv. citri (strain 306) GN=carA PE=3 SV=1 24 423 1.0E-61
sp|Q8DEM1|CARA_VIBVU Carbamoyl-phosphate synthase small chain OS=Vibrio vulnificus (strain CMCP6) GN=carA PE=3 SV=1 24 419 2.0E-61
sp|B8IZS6|CARA_DESDA Carbamoyl-phosphate synthase small chain OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=carA PE=3 SV=1 24 415 3.0E-61
sp|Q1XDT6|CARA_PYRYE Carbamoyl-phosphate synthase small chain OS=Pyropia yezoensis GN=carA PE=3 SV=1 24 417 5.0E-61
sp|Q6G5M0|CARA_BARHE Carbamoyl-phosphate synthase small chain OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=carA PE=3 SV=1 24 420 9.0E-61
sp|Q7MNU1|CARA_VIBVY Carbamoyl-phosphate synthase small chain OS=Vibrio vulnificus (strain YJ016) GN=carA PE=3 SV=1 24 419 1.0E-60
sp|Q87SF4|CARA_VIBPA Carbamoyl-phosphate synthase small chain OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=carA PE=3 SV=1 21 419 1.0E-60
sp|Q9WZ28|CARA_THEMA Carbamoyl-phosphate synthase small chain OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=carA PE=3 SV=1 23 415 1.0E-60
sp|Q9LVW7|CARA_ARATH Carbamoyl-phosphate synthase small chain, chloroplastic OS=Arabidopsis thaliana GN=CARA PE=1 SV=1 24 417 2.0E-60
sp|B8GNX4|CARA_THISH Carbamoyl-phosphate synthase small chain OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=carA PE=3 SV=1 24 417 2.0E-60
sp|P36838|CARX_BACSU Carbamoyl-phosphate synthase arginine-specific small chain OS=Bacillus subtilis (strain 168) GN=carA PE=3 SV=2 24 427 2.0E-60
sp|Q827Q8|CARA_STRAW Carbamoyl-phosphate synthase small chain OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=carA PE=3 SV=1 23 416 2.0E-60
sp|Q9CFV2|CARB_LACLA Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=carB PE=3 SV=1 442 871 3.0E-60
sp|Q8EHS6|CARA_SHEON Carbamoyl-phosphate synthase small chain OS=Shewanella oneidensis (strain MR-1) GN=carA PE=3 SV=1 24 419 3.0E-60
sp|O19886|CARA_CYACA Carbamoyl-phosphate synthase small chain OS=Cyanidium caldarium GN=carA PE=3 SV=1 24 416 3.0E-60
sp|Q9K9V9|CARB_BACHD Carbamoyl-phosphate synthase pyrimidine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrAB PE=3 SV=1 435 840 4.0E-60
sp|Q9PEC2|CARA_XYLFA Carbamoyl-phosphate synthase small chain OS=Xylella fastidiosa (strain 9a5c) GN=carA PE=3 SV=2 24 421 4.0E-60
sp|P38098|CARA_PSEAE Carbamoyl-phosphate synthase small chain OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=carA PE=3 SV=1 24 419 4.0E-60
sp|Q9KPH8|CARA_VIBCH Carbamoyl-phosphate synthase small chain OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=carA PE=3 SV=1 24 419 4.0E-60
sp|Q88DU5|CARA_PSEPK Carbamoyl-phosphate synthase small chain OS=Pseudomonas putida (strain KT2440) GN=carA PE=3 SV=1 24 419 5.0E-60
sp|Q87EB9|CARA_XYLFT Carbamoyl-phosphate synthase small chain OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=carA PE=3 SV=1 24 421 5.0E-60
sp|P38099|CARA_PSEST Carbamoyl-phosphate synthase small chain OS=Pseudomonas stutzeri GN=carA PE=3 SV=1 24 419 7.0E-60
sp|Q66ER8|CARA_YERPS Carbamoyl-phosphate synthase small chain OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=carA PE=3 SV=1 24 421 1.0E-59
sp|Q8ZIL5|CARA_YERPE Carbamoyl-phosphate synthase small chain OS=Yersinia pestis GN=carA PE=3 SV=1 24 421 1.0E-59
sp|Q1MPN3|CARA_LAWIP Carbamoyl-phosphate synthase small chain OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=carA PE=3 SV=1 24 420 2.0E-59
sp|Q6F8M7|CARA_ACIAD Carbamoyl-phosphate synthase small chain OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=carA PE=3 SV=1 24 424 2.0E-59
sp|O32771|CARB_LACLM Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=carB PE=2 SV=2 442 871 4.0E-59
sp|Q02YG5|CARB_LACLS Carbamoyl-phosphate synthase large chain OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=carB PE=3 SV=1 442 871 4.0E-59
sp|Q89DR8|CARA_BRADU Carbamoyl-phosphate synthase small chain OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=carA PE=3 SV=1 24 417 5.0E-59
sp|C5BQ30|CARA_TERTT Carbamoyl-phosphate synthase small chain OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=carA PE=3 SV=1 24 417 5.0E-59
sp|O67233|CARB2_AQUAE Carbamoyl-phosphate synthase large chain, C-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB2 PE=3 SV=1 454 837 9.0E-59
sp|B9EB69|CARB_MACCJ Carbamoyl-phosphate synthase large chain OS=Macrococcus caseolyticus (strain JCSC5402) GN=carB PE=3 SV=1 435 840 2.0E-58
sp|Q7N8W2|CARA_PHOLL Carbamoyl-phosphate synthase small chain OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=carA PE=3 SV=1 24 419 2.0E-58
sp|Q6NH15|CARA_CORDI Carbamoyl-phosphate synthase small chain OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=carA PE=3 SV=1 17 424 2.0E-58
sp|Q6B940|CARA_GRATL Carbamoyl-phosphate synthase small chain OS=Gracilaria tenuistipitata var. liui GN=carA PE=3 SV=1 24 419 2.0E-58
sp|Q9KXR5|CARA_STRCO Carbamoyl-phosphate synthase small chain OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=carA PE=3 SV=1 23 417 5.0E-58
sp|Q1D6Y8|CARB_MYXXD Carbamoyl-phosphate synthase large chain OS=Myxococcus xanthus (strain DK 1622) GN=carB PE=3 SV=1 442 837 6.0E-58
sp|O50235|CARA_ZYMMO Carbamoyl-phosphate synthase small chain OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=carA PE=3 SV=2 26 419 1.0E-57
sp|Q9CKV3|CARA_PASMU Carbamoyl-phosphate synthase small chain OS=Pasteurella multocida (strain Pm70) GN=carA PE=3 SV=1 24 417 1.0E-57
sp|Q8K9Z6|CARA_BUCAP Carbamoyl-phosphate synthase small chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carA PE=3 SV=1 21 416 3.0E-57
sp|Q9JVZ6|CARA_NEIMA Carbamoyl-phosphate synthase small chain OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=carA PE=3 SV=1 24 424 3.0E-57
sp|O28994|CARB_ARCFU Carbamoyl-phosphate synthase large chain OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=carB PE=3 SV=1 441 837 4.0E-57
sp|Q97FT3|CARB_CLOAB Carbamoyl-phosphate synthase large chain OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=carB PE=3 SV=1 442 897 4.0E-57
sp|Q6D0C8|CARA_PECAS Carbamoyl-phosphate synthase small chain OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=carA PE=3 SV=1 24 419 7.0E-57
sp|Q9A4J7|CARA_CAUCR Carbamoyl-phosphate synthase small chain OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=carA PE=3 SV=1 23 415 8.0E-57
sp|Q71YI1|CARB_LISMF Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain F2365) GN=carB PE=3 SV=1 441 847 9.0E-57
sp|B8DDR7|CARB_LISMH Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=carB PE=3 SV=1 441 847 9.0E-57
sp|Q7VP66|CARA_HAEDU Carbamoyl-phosphate synthase small chain OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=carA PE=3 SV=1 24 421 1.0E-56
sp|Q6LUK6|CARA_PHOPR Carbamoyl-phosphate synthase small chain OS=Photobacterium profundum GN=carA PE=3 SV=1 24 419 1.0E-56
sp|Q9JXX4|CARA_NEIMB Carbamoyl-phosphate synthase small chain OS=Neisseria meningitidis serogroup B (strain MC58) GN=carA PE=3 SV=1 24 424 1.0E-56
sp|Q8FT41|CARA_COREF Carbamoyl-phosphate synthase small chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carA PE=3 SV=1 24 416 1.0E-56
sp|Q8RG86|CARB_FUSNN Carbamoyl-phosphate synthase large chain OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=carB PE=3 SV=2 442 860 2.0E-56
sp|A0AJU0|CARB_LISW6 Carbamoyl-phosphate synthase large chain OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=carB PE=3 SV=1 441 847 2.0E-56
sp|A5GTM5|CARA_SYNR3 Carbamoyl-phosphate synthase small chain OS=Synechococcus sp. (strain RCC307) GN=carA PE=3 SV=1 24 431 2.0E-56
sp|P9WPK5|CARA_MYCTU Carbamoyl-phosphate synthase small chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carA PE=1 SV=1 23 424 3.0E-56
sp|P9WPK4|CARA_MYCTO Carbamoyl-phosphate synthase small chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carA PE=3 SV=1 23 424 3.0E-56
sp|Q92AH3|CARB_LISIN Carbamoyl-phosphate synthase large chain OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=carB PE=3 SV=1 441 847 4.0E-56
sp|Q58776|CARB2_METJA Carbamoyl-phosphate synthase large chain, C-terminal section OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carB2 PE=3 SV=1 454 837 4.0E-56
sp|C1KWD4|CARB_LISMC Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=carB PE=3 SV=1 441 847 8.0E-56
sp|P57245|CARA_BUCAI Carbamoyl-phosphate synthase small chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carA PE=3 SV=1 21 421 9.0E-56
sp|Q7U055|CARA_MYCBO Carbamoyl-phosphate synthase small chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carA PE=3 SV=1 23 424 1.0E-55
sp|O25835|CARA_HELPY Carbamoyl-phosphate synthase small chain OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=carA PE=3 SV=1 21 417 1.0E-55
sp|Q17VI1|CARA_HELAH Carbamoyl-phosphate synthase small chain OS=Helicobacter acinonychis (strain Sheeba) GN=carA PE=3 SV=1 21 416 1.0E-55
sp|Q8Y665|CARB_LISMO Carbamoyl-phosphate synthase large chain OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=carB PE=3 SV=1 441 847 2.0E-55
sp|Q7VHS5|CARA_HELHP Carbamoyl-phosphate synthase small chain OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=carA PE=3 SV=1 24 415 2.0E-55
sp|Q741H2|CARA_MYCPA Carbamoyl-phosphate synthase small chain OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=carA PE=3 SV=1 20 417 9.0E-55
sp|B1MZ74|CARB_LEUCK Carbamoyl-phosphate synthase large chain OS=Leuconostoc citreum (strain KM20) GN=carB PE=3 SV=1 442 840 1.0E-54
sp|Q8Z9L7|CARB_SALTI Carbamoyl-phosphate synthase large chain OS=Salmonella typhi GN=carB PE=3 SV=3 439 837 1.0E-54
sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carB PE=2 SV=3 453 871 1.0E-54
sp|Q8G816|CARA_BIFLO Carbamoyl-phosphate synthase small chain OS=Bifidobacterium longum (strain NCC 2705) GN=carA PE=3 SV=1 18 417 1.0E-54
sp|B3DQ31|CARA_BIFLD Carbamoyl-phosphate synthase small chain OS=Bifidobacterium longum (strain DJO10A) GN=carA PE=3 SV=1 18 417 1.0E-54
sp|B7GPW1|CARA_BIFLS Carbamoyl-phosphate synthase small chain OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=carA PE=3 SV=1 18 417 1.0E-54
sp|P14846|CARB_SALTY Carbamoyl-phosphate synthase large chain OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=carB PE=3 SV=4 439 837 2.0E-54
sp|Q8ZIL4|CARB_YERPE Carbamoyl-phosphate synthase large chain OS=Yersinia pestis GN=carB PE=3 SV=3 439 838 2.0E-54
sp|Q9CCR3|CARA_MYCLE Carbamoyl-phosphate synthase small chain OS=Mycobacterium leprae (strain TN) GN=carA PE=3 SV=1 24 421 2.0E-54
sp|Q8FLB0|CARB_ECOL6 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=carB PE=3 SV=3 439 837 5.0E-54
sp|P00968|CARB_ECOLI Carbamoyl-phosphate synthase large chain OS=Escherichia coli (strain K12) GN=carB PE=1 SV=2 439 837 5.0E-54
sp|Q50983|CARA_NEIGO Carbamoyl-phosphate synthase small chain OS=Neisseria gonorrhoeae GN=carA PE=3 SV=1 24 416 6.0E-54
sp|P63738|CARB_SHIFL Carbamoyl-phosphate synthase large chain OS=Shigella flexneri GN=carB PE=3 SV=2 439 837 2.0E-53
sp|P63737|CARB_ECO57 Carbamoyl-phosphate synthase large chain OS=Escherichia coli O157:H7 GN=carB PE=3 SV=2 439 837 2.0E-53
sp|Q9ZJY9|CARA_HELPJ Carbamoyl-phosphate synthase small chain OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=carA PE=3 SV=1 21 416 3.0E-53
sp|P59576|CARA_BUCBP Carbamoyl-phosphate synthase small chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carA PE=3 SV=1 24 416 4.0E-53
sp|Q0AMR3|CARA_MARMM Carbamoyl-phosphate synthase small chain OS=Maricaulis maris (strain MCS10) GN=carA PE=3 SV=1 23 416 5.0E-53
sp|A3CU73|CARB_METMJ Carbamoyl-phosphate synthase large chain OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=carB PE=3 SV=1 449 900 2.0E-52
sp|Q58773|CARB1_METJA Carbamoyl-phosphate synthase large chain, N-terminal section OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=carB1 PE=3 SV=2 996 1367 6.0E-52
sp|P58893|CARA_CORGL Carbamoyl-phosphate synthase small chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carA PE=3 SV=1 24 424 6.0E-52
sp|Q9HP42|CARA_HALSA Carbamoyl-phosphate synthase small chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=carA PE=3 SV=1 45 413 2.0E-51
sp|B0R6F1|CARA_HALS3 Carbamoyl-phosphate synthase small chain OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=carA PE=3 SV=1 45 413 2.0E-51
sp|Q0BY73|CARA_HYPNA Carbamoyl-phosphate synthase small chain OS=Hyphomonas neptunium (strain ATCC 15444) GN=carA PE=3 SV=1 18 415 3.0E-51
sp|C1F1S6|CARB_ACIC5 Carbamoyl-phosphate synthase large chain OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=carB PE=3 SV=1 442 837 1.0E-50
sp|P59448|CARB_BUCBP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=carB PE=3 SV=1 439 840 3.0E-50
sp|Q7UJ58|CARB_RHOBA Carbamoyl-phosphate synthase large chain OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=carB PE=3 SV=1 439 837 7.0E-50
sp|Q9PMG8|CARA_CAMJE Carbamoyl-phosphate synthase small chain OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=carA PE=3 SV=1 26 417 8.0E-50
sp|Q9HP43|CARB_HALSA Carbamoyl-phosphate synthase large chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=carB PE=3 SV=1 453 859 1.0E-49
sp|Q9RLS9|CARY_LACPL Carbamoyl-phosphate synthase arginine-specific large chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carB PE=2 SV=3 994 1367 3.0E-49
sp|O67869|CARB1_AQUAE Carbamoyl-phosphate synthase large chain, N-terminal section OS=Aquifex aeolicus (strain VF5) GN=carB1 PE=3 SV=1 992 1431 3.0E-49
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 439 838 1.0E-48
sp|Q97AJ4|CARA_THEVO Carbamoyl-phosphate synthase small chain OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=carA PE=3 SV=1 24 412 1.0E-48
sp|B9DPN2|CARB_STACT Carbamoyl-phosphate synthase large chain OS=Staphylococcus carnosus (strain TM300) GN=carB PE=3 SV=1 992 1372 2.0E-48
sp|B2G564|CARB_LACRJ Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain JCM 1112) GN=carB PE=3 SV=1 442 837 2.0E-48
sp|A5VHN6|CARB_LACRD Carbamoyl-phosphate synthase large chain OS=Lactobacillus reuteri (strain DSM 20016) GN=carB PE=3 SV=1 442 837 2.0E-48
sp|B2GD06|CARB_LACF3 Carbamoyl-phosphate synthase large chain OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=carB PE=3 SV=1 442 969 4.0E-48
sp|Q9K8V7|CARY_BACHD Carbamoyl-phosphate synthase arginine-specific large chain OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=carB PE=3 SV=1 442 837 1.0E-47
sp|Q9HK16|CARA_THEAC Carbamoyl-phosphate synthase small chain OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=carA PE=3 SV=2 24 412 1.0E-47
sp|Q7U054|CARB_MYCBO Carbamoyl-phosphate synthase large chain OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=carB PE=3 SV=1 448 837 4.0E-47
sp|Q8TWX0|CARB1_METKA Carbamoyl-phosphate synthase large chain, N-terminal section OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=carB1 PE=3 SV=1 996 1367 5.0E-47
sp|P9WPK3|CARB_MYCTU Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=carB PE=1 SV=1 448 837 7.0E-47
sp|P9WPK2|CARB_MYCTO Carbamoyl-phosphate synthase large chain OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=carB PE=3 SV=1 448 837 7.0E-47
sp|B0K4D7|CARB_THEPX Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter sp. (strain X514) GN=carB PE=3 SV=1 992 1367 1.0E-46
sp|B9KXM5|CARB_THERP Carbamoyl-phosphate synthase large chain OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=carB PE=3 SV=1 442 831 2.0E-46
sp|O08317|CARX_LACPL Carbamoyl-phosphate synthase arginine-specific small chain OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=carA PE=2 SV=3 24 416 5.0E-46
sp|P57244|CARB_BUCAI Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carB PE=3 SV=2 439 838 7.0E-46
sp|B0KBW4|CARB_THEP3 Carbamoyl-phosphate synthase large chain OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=carB PE=3 SV=1 992 1367 2.0E-45
sp|A4TBY6|CARB_MYCGI Carbamoyl-phosphate synthase large chain OS=Mycobacterium gilvum (strain PYR-GCK) GN=carB PE=3 SV=1 448 837 5.0E-44
sp|Q9CCR2|CARB_MYCLE Carbamoyl-phosphate synthase large chain OS=Mycobacterium leprae (strain TN) GN=carB PE=3 SV=2 448 837 6.0E-44
sp|Q1B9F9|CARB_MYCSS Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain MCS) GN=carB PE=3 SV=1 448 837 1.0E-43
sp|A1UFK4|CARB_MYCSK Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain KMS) GN=carB PE=3 SV=1 448 837 1.0E-43
sp|A3PZ65|CARB_MYCSJ Carbamoyl-phosphate synthase large chain OS=Mycobacterium sp. (strain JLS) GN=carB PE=3 SV=1 448 837 1.0E-43
sp|P57244|CARB_BUCAI Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=carB PE=3 SV=2 992 1365 2.0E-43
sp|A1T8H1|CARB_MYCVP Carbamoyl-phosphate synthase large chain OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=carB PE=3 SV=1 448 837 2.0E-43
sp|Q8U085|CARB_PYRFU Carbamoyl-phosphate synthase large chain OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=carB PE=3 SV=1 448 855 6.0E-43
sp|P58939|CARB_CORGL Carbamoyl-phosphate synthase large chain OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=carB PE=3 SV=1 448 830 2.0E-42
sp|Q8K9Z7|CARB_BUCAP Carbamoyl-phosphate synthase large chain OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=carB PE=3 SV=3 992 1370 3.0E-42
sp|Q8FT42|CARB_COREF Carbamoyl-phosphate synthase large chain OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=carB PE=3 SV=1 448 837 3.0E-41
sp|Q9HP43|CARB_HALSA Carbamoyl-phosphate synthase large chain OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=carB PE=3 SV=1 992 1370 6.0E-36
sp|Q8D3H7|CARA_WIGBR Carbamoyl-phosphate synthase small chain OS=Wigglesworthia glossinidia brevipalpis GN=carA PE=3 SV=1 237 419 1.0E-32
sp|P13258|CARB_METBA Carbamoyl-phosphate synthase large chain (Fragment) OS=Methanosarcina barkeri GN=carB PE=3 SV=1 592 842 2.0E-26
sp|Q8D3H7|CARA_WIGBR Carbamoyl-phosphate synthase small chain OS=Wigglesworthia glossinidia brevipalpis GN=carA PE=3 SV=1 24 160 4.0E-15
sp|P9WN35|TRPG_MYCTU Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trpG PE=1 SV=1 235 431 1.0E-10
sp|P9WN34|TRPG_MYCTO Anthranilate synthase component 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trpG PE=3 SV=1 235 431 1.0E-10
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 1016 1309 1.0E-09
sp|P32528|DUR1_YEAST Urea amidolyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUR1,2 PE=1 SV=2 1016 1301 2.0E-09
sp|Q58626|PYCA_METJA Pyruvate carboxylase subunit A OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pycA PE=1 SV=1 1016 1339 2.0E-09
sp|Q3A590|GUAA_PELCD GMP synthase [glutamine-hydrolyzing] OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=guaA PE=3 SV=1 236 463 4.0E-09
sp|Q7M8K2|GUAA_WOLSU GMP synthase [glutamine-hydrolyzing] OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=guaA PE=3 SV=1 235 463 5.0E-09
sp|Q08654|TRPGD_THEMA Bifunctional protein TrpGD OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=trpGD PE=3 SV=2 280 401 3.0E-08
sp|F4I1L3|ACC2_ARATH Acetyl-CoA carboxylase 2 OS=Arabidopsis thaliana GN=ACC2 PE=2 SV=1 527 775 4.0E-08
sp|D3DJ42|2OCS_HYDTT 2-oxoglutarate carboxylase small subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiB PE=1 SV=1 1016 1306 2.0E-07
sp|A1AXH0|GUAA_RUTMC GMP synthase [glutamine-hydrolyzing] OS=Ruthia magnifica subsp. Calyptogena magnifica GN=guaA PE=3 SV=1 236 425 2.0E-07
sp|Q8S6N5|ACC1_ORYSJ Acetyl-CoA carboxylase 1 OS=Oryza sativa subsp. japonica GN=ACC1 PE=3 SV=1 578 775 2.0E-07
sp|B9FK36|ACC2_ORYSJ Acetyl-CoA carboxylase 2 OS=Oryza sativa subsp. japonica GN=ACC2 PE=3 SV=2 579 775 2.0E-07
sp|O30019|PYCA_ARCFU Pyruvate carboxylase subunit A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pycA PE=3 SV=1 1016 1339 4.0E-07
sp|B9KH18|GUAA_ANAMF GMP synthase [glutamine-hydrolyzing] OS=Anaplasma marginale (strain Florida) GN=guaA PE=3 SV=1 237 425 8.0E-07
sp|Q5P9L5|GUAA_ANAMM GMP synthase [glutamine-hydrolyzing] OS=Anaplasma marginale (strain St. Maries) GN=guaA PE=3 SV=1 237 425 9.0E-07
sp|Q5V632|TRPG2_HALMA Anthranilate synthase component II OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=trpG2 PE=3 SV=1 278 401 9.0E-07
sp|P60500|GUAA_GEOSL GMP synthase [glutamine-hydrolyzing] OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=guaA PE=3 SV=1 234 463 1.0E-06
sp|A5H0J2|DUR1_LACKL Urea amidolyase OS=Lachancea kluyveri GN=DUR1,2 PE=3 SV=1 1016 1301 1.0E-06
sp|A6ZMR9|HFA1_YEAS7 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=HFA1 PE=3 SV=2 560 777 1.0E-06
sp|Q54J08|ACAC_DICDI Acetyl-CoA carboxylase OS=Dictyostelium discoideum GN=accA PE=3 SV=1 590 775 1.0E-06
sp|P32874|HFA1_YEAST Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFA1 PE=1 SV=2 560 777 1.0E-06
sp|P06195|PABA_SERMA Aminodeoxychorismate synthase component 2 OS=Serratia marcescens GN=pabA PE=3 SV=1 246 417 2.0E-06
sp|Q9KWU4|PYC_BACSU Pyruvate carboxylase OS=Bacillus subtilis (strain 168) GN=pyc PE=3 SV=1 1015 1353 2.0E-06
sp|P11154|PYC1_YEAST Pyruvate carboxylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PYC1 PE=1 SV=2 453 756 2.0E-06
sp|Q31AM1|PURT_PROM9 Phosphoribosylglycinamide formyltransferase 2 OS=Prochlorococcus marinus (strain MIT 9312) GN=purT PE=3 SV=1 1088 1308 2.0E-06
sp|O27939|PYCA_METTH Pyruvate carboxylase subunit A OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pycA PE=1 SV=1 454 759 3.0E-06
sp|C7GRE4|HFA1_YEAS2 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain JAY291) GN=HFA1 PE=3 SV=2 560 777 3.0E-06
sp|C8ZF72|HFA1_YEAS8 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HFA1 PE=3 SV=2 560 777 3.0E-06
sp|B3LM95|HFA1_YEAS1 Acetyl-CoA carboxylase, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HFA1 PE=3 SV=2 560 777 3.0E-06
sp|P06194|PABA_ENTAE Aminodeoxychorismate synthase component 2 OS=Enterobacter aerogenes GN=pabA PE=3 SV=1 244 401 3.0E-06
sp|Q38970|ACC1_ARATH Acetyl-CoA carboxylase 1 OS=Arabidopsis thaliana GN=ACC1 PE=1 SV=1 527 775 5.0E-06
sp|Q8PK88|GUAA_XANAC GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas axonopodis pv. citri (strain 306) GN=guaA PE=3 SV=1 233 338 6.0E-06
sp|B2SLG1|GUAA_XANOP GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=guaA PE=3 SV=1 233 338 7.0E-06
sp|Q5H0S2|GUAA_XANOR GMP synthase [glutamine-hydrolyzing] OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=guaA PE=3 SV=2 233 338 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008716 D-alanine-D-alanine ligase activity Yes
GO:0005524 ATP binding Yes
GO:0032553 ribonucleotide binding No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:0016874 ligase activity No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0016881 acid-amino acid ligase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|258
MVVAALPPAAARMASVEDEGLVCLELEDGSAYQGYSFGAKRSVAGELVFQTGLVGYPESLTDPSYRGQILVITFP
LVGNYGVPARDALDDLCRDLPAHFESSQIHVAGLVTASYCGEDFSHFLAASSLGAWLKEQGVPAVYGVDTRALTK
KIRQQGSMLGRMRLQTRALPDVPPPAPHGRAPGALPAASLDHFEDIAWANPNEQNLVAEVSVRAPKLYKPPPSVS
AREHPSGRTVRILCVDVGMKYNQLRCFLKRGVEVLVCPWDHDLAGEAAGERYDGLFISNGPGDPAVLDATVANIR
AAMDGNKTPVFGICLGHQLLARAAGAATAKMKFGNRGHNIPCTSMVTGKCHITSQNHGYAVEAGSLPAGWRELFV
NANDGSNEGIMHVGRPHFSVQFHPESTPGPRDTEFLFDVFVDAVVACARDPALLRRPVSFPGGTVEENERLHPRV
SVHKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTVLINPNIATIQTSKGLADKVYFLPVDADFVRKVIHY
ERPDAIYVTFGGQTALQVGIQLKDEFEGLGVRVLGTPIDTIITTEDRELFARSMESIGEKCAKSASASSVEEALD
VVQGIGFPVIVRAAYALGGLGSGFANDERELLDLCNKAFAASPQVLIERSMKGWKEIEYEVVRDAQDNCITVCNM
ENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSREYCIIEVNARLSRSSAL
ASKATGYPLAFIAAKLGLGIPLKEVSNSVTRVTCACFEPSLDYVVVKMPRWDLKKFTRVSTQLGSSMKSVGEVMS
IGRSFEEAIQKAIRAIDFHNLGFGETQALVSIDDELQTPSDQRLFAIANAMHGGYSVDKIWEMTKIDKWFLRKLK
GLSDFAKDMARLTTRDVARSPGLMLQAKRLGFCDRQLAKFWDSNEIAVRRLRLEAGVKPFVKQIDTVAAEFPAFT
NYLYLTYNASEHDVGFDDHGVMVLGSGVYRIGSSVEFDWCSVRAIRTLRRSGFKTIMVNYNPETVSTDYDEADKL
YFENINLETVLDVYQLEGASGVLGAMGGQTPNNIALPLHRAGVKVLGTSPEMIDMAENRYKFSRMLDRIEVDQPT
WRELTSFEEAREFCQAVGYPVLVRPSYVLSGAAMNTVYSEKDLVNYLAQAAEVSREHPVVISKYIEGAKEIEMDA
VAKDGVVVGHFISEHVENAGVHSGDATLILPPQDLEATTIGRIEEATRKIGAALNVTGPFNIQFIAKDNDIKVIE
CNVRASRSFPFVSKVMGVDLIEMATRAITGQPFQEYPATTLGPDCVGVKVPQFSFSRLSGADPVLGVEMASTGEV
ACFGVDKYEAYLKALLSTGFRIPKANVLLSIGSYKDKREMLPSVQKLQRIGYKLFATAGTADFLQEHGVSVQFLE
VLGRDEDMNSEFSLTQHLAKNTIDLYINLPSNNKYRRPANYMSRGYQTRRMAVDYQIPLVTNVKNAKILVEAIAR
HVYLDVRRR*
Coding >Hirsu2|258
ATGGTCGTCGCAGCACTGCCGCCCGCCGCGGCGCGCATGGCGAGCGTCGAGGACGAGGGCCTCGTCTGCCTCGAG
CTCGAGGACGGCTCCGCCTACCAGGGCTACAGCTTCGGCGCCAAGCGCAGCGTCGCCGGCGAGCTCGTCTTCCAG
ACCGGCCTCGTCGGCTACCCCGAGTCGCTGACGGACCCGTCCTACCGCGGCCAGATCCTCGTCATCACCTTCCCC
CTCGTCGGCAACTACGGCGTGCCCGCCCGCGACGCCCTCGACGACCTGTGCCGCGACCTGCCCGCCCACTTCGAG
TCGTCGCAGATCCACGTCGCCGGCCTCGTCACCGCCTCCTACTGCGGCGAGGACTTCTCCCACTTCCTCGCCGCC
TCCTCCCTCGGCGCCTGGCTCAAGGAGCAGGGCGTCCCGGCCGTCTACGGCGTCGACACCCGCGCCCTCACCAAG
AAGATACGCCAGCAGGGCAGCATGCTCGGCCGCATGAGGCTCCAGACGCGCGCCCTGCCCGACGTGCCCCCTCCC
GCCCCCCACGGCCGCGCCCCCGGCGCCCTGCCCGCCGCCTCGCTCGACCACTTTGAGGACATTGCCTGGGCGAAC
CCCAACGAGCAGAATCTCGTGGCCGAGGTCTCCGTCAGGGCCCCGAAGCTCTACAAGCCGCCGCCCTCGGTCTCT
GCCCGCGAGCACCCCTCCGGCCGCACCGTCCGCATCCTCTGCGTCGACGTCGGCATGAAGTACAACCAGCTCCGG
TGCTTCCTCAAGCGCGGCGTCGAGGTCCTGGTCTGCCCCTGGGACCACGACCTGGCCGGCGAGGCGGCCGGCGAG
CGGTACGACGGCCTCTTCATCTCCAACGGGCCCGGCGACCCGGCCGTGCTCGACGCCACCGTCGCCAACATCCGA
GCCGCCATGGACGGCAACAAGACGCCCGTCTTCGGCATCTGCCTCGGCCACCAGCTGCTGGCCAGGGCCGCGGGC
GCCGCGACGGCCAAGATGAAGTTCGGCAACCGCGGCCACAACATCCCCTGCACCAGCATGGTCACCGGCAAGTGC
CACATCACGTCGCAGAACCACGGGTACGCCGTCGAGGCCGGCTCCCTGCCCGCCGGCTGGCGGGAGCTCTTCGTC
AACGCAAACGACGGCAGCAACGAGGGCATCATGCACGTCGGCCGCCCCCACTTCAGCGTCCAGTTCCACCCGGAG
AGCACGCCCGGCCCGCGCGACACCGAGTTCCTGTTCGACGTCTTCGTCGACGCCGTCGTCGCCTGCGCCCGCGAC
CCGGCCCTCCTGCGCCGGCCCGTCAGCTTCCCCGGCGGCACGGTCGAGGAGAACGAGCGGCTGCACCCGCGCGTC
TCGGTCCACAAGGTCCTCGTCCTCGGCAGCGGCGGCCTCAGCATCGGCCAGGCCGGCGAGTTCGACTACTCGGGC
AGCCAGGCCATCAAGGCGCTCAAGGAGGAGGGCATCTACACCGTCCTCATCAACCCCAACATCGCCACCATCCAG
ACGTCCAAGGGCCTGGCCGACAAGGTCTACTTCCTGCCCGTCGACGCCGACTTCGTCCGCAAGGTGATACACTAC
GAGCGCCCGGACGCCATCTACGTCACCTTCGGCGGCCAGACGGCGCTCCAGGTCGGCATCCAGCTCAAGGACGAG
TTCGAGGGGCTCGGCGTCAGGGTGCTGGGCACGCCCATCGACACCATCATCACCACCGAGGACCGCGAGCTCTTC
GCGCGCAGCATGGAGTCCATCGGCGAGAAGTGCGCCAAGTCGGCCTCGGCCAGCAGCGTCGAGGAGGCGCTCGAC
GTGGTCCAGGGCATCGGCTTCCCCGTCATCGTCCGCGCCGCCTACGCGCTCGGCGGCCTGGGCAGCGGCTTCGCC
AACGACGAGCGCGAGCTGCTCGACCTCTGCAACAAGGCCTTCGCCGCCAGCCCGCAGGTGCTGATCGAGCGCAGC
ATGAAGGGCTGGAAGGAGATCGAGTACGAGGTGGTGCGCGACGCCCAGGACAACTGCATCACCGTCTGCAACATG
GAGAACTTCGACCCGCTGGGCATCCACACGGGCGACTCCATCGTCGTCGCCCCGTCGCAGACGCTGTCGGACGAG
GACTACAACATGCTGCGGACGACGGCCGTCAACGTGATCCGCCACCTCGGCGTCGTCGGCGAGTGCAACATCCAG
TACGCCCTCAACCCCTTCTCGCGCGAGTACTGCATCATCGAGGTCAACGCGCGGCTGTCGCGGTCGTCGGCGCTG
GCCTCCAAGGCGACCGGCTACCCGCTGGCCTTCATCGCCGCCAAGCTCGGGCTGGGGATCCCGCTCAAGGAGGTG
TCCAACTCGGTGACGCGGGTGACGTGCGCCTGCTTCGAGCCGTCGCTCGACTACGTCGTCGTCAAGATGCCGCGC
TGGGACCTCAAGAAGTTCACGCGCGTCTCGACCCAGCTGGGCTCGTCGATGAAGAGCGTCGGCGAGGTCATGAGC
ATCGGGCGCTCCTTCGAGGAGGCGATCCAGAAGGCGATCCGGGCCATCGACTTCCACAACCTCGGCTTCGGCGAG
ACGCAGGCGCTGGTGAGCATCGACGACGAGCTGCAGACGCCGTCGGACCAGCGGCTGTTCGCCATCGCCAACGCC
ATGCACGGGGGCTACTCGGTCGACAAGATCTGGGAGATGACCAAGATCGACAAGTGGTTCCTGCGCAAGCTCAAG
GGCCTCAGCGACTTCGCCAAGGACATGGCGCGGCTCACGACGCGCGACGTGGCGCGGTCGCCGGGCCTCATGCTG
CAGGCCAAGCGGCTCGGCTTCTGCGACCGGCAGCTGGCCAAGTTCTGGGACTCGAACGAGATCGCGGTGCGGCGG
CTGCGGCTCGAGGCGGGCGTCAAGCCGTTCGTCAAGCAGATCGACACGGTCGCGGCCGAGTTCCCGGCCTTCACC
AACTACCTGTACCTGACGTACAACGCGTCGGAGCACGACGTCGGCTTCGACGACCACGGCGTCATGGTGCTCGGC
TCGGGCGTGTACCGCATCGGGTCGTCGGTCGAGTTCGACTGGTGCTCGGTGCGGGCGATCCGGACGCTGCGCCGG
TCGGGCTTCAAGACGATCATGGTCAACTACAACCCGGAGACGGTGAGCACCGACTACGACGAGGCCGACAAGCTG
TACTTTGAGAACATCAACCTGGAGACGGTGCTGGACGTGTACCAGCTCGAGGGCGCGAGCGGGGTGCTGGGGGCC
ATGGGCGGGCAGACGCCCAACAACATCGCGCTGCCGCTGCACCGGGCGGGCGTCAAGGTGCTGGGGACGTCGCCC
GAGATGATCGACATGGCGGAGAACCGGTACAAGTTCTCGCGGATGCTGGACCGGATCGAGGTGGACCAGCCGACG
TGGCGGGAGCTGACGAGCTTCGAGGAGGCGCGCGAGTTCTGCCAGGCCGTCGGCTACCCGGTGCTGGTGCGGCCG
TCGTACGTGCTGTCGGGCGCGGCCATGAACACGGTCTACTCGGAGAAGGACCTGGTCAACTACCTGGCGCAGGCG
GCCGAGGTGTCGCGCGAGCACCCGGTCGTCATCTCCAAGTACATTGAGGGGGCCAAGGAGATCGAGATGGACGCG
GTGGCCAAGGACGGCGTGGTGGTGGGCCACTTCATCTCGGAGCACGTGGAGAACGCGGGGGTGCACTCGGGCGAC
GCGACGCTGATCCTGCCGCCGCAGGACCTGGAGGCGACGACGATCGGGCGGATCGAGGAGGCGACGCGCAAGATC
GGGGCGGCGCTCAACGTGACGGGGCCCTTCAACATCCAGTTCATCGCCAAGGACAACGACATCAAGGTGATTGAG
TGCAACGTGCGGGCCTCGCGCTCCTTCCCCTTCGTGTCCAAGGTGATGGGCGTGGACCTGATCGAGATGGCGACG
CGGGCCATCACGGGGCAGCCGTTCCAGGAGTACCCGGCGACGACGCTGGGGCCGGACTGCGTGGGCGTCAAGGTG
CCGCAGTTCAGCTTCTCGCGCCTGTCCGGGGCGGACCCGGTGCTGGGCGTCGAGATGGCGTCGACGGGCGAGGTG
GCCTGCTTCGGCGTCGACAAGTACGAGGCCTACCTCAAGGCGCTGCTGTCGACGGGCTTCCGGATCCCCAAGGCC
AACGTGCTGCTGTCGATCGGGTCCTACAAGGACAAGCGGGAGATGCTGCCGTCGGTGCAGAAGCTGCAGCGGATC
GGCTACAAGCTGTTCGCGACGGCCGGCACGGCCGACTTTTTGCAGGAGCACGGCGTGTCGGTGCAGTTCCTCGAG
GTGCTGGGCCGGGACGAGGACATGAACTCGGAGTTTTCGCTGACGCAGCACCTGGCCAAGAACACCATCGACCTG
TACATCAACCTGCCGTCCAACAACAAGTACCGGCGGCCGGCCAACTACATGAGCCGGGGCTACCAGACGCGGCGC
ATGGCGGTCGACTACCAGATCCCGCTGGTGACCAACGTCAAGAACGCCAAGATCCTGGTCGAGGCCATCGCGCGG
CACGTGTACCTGGACGTACGCCGGAGATGA
Transcript >Hirsu2|258
ATGGTCGTCGCAGCACTGCCGCCCGCCGCGGCGCGCATGGCGAGCGTCGAGGACGAGGGCCTCGTCTGCCTCGAG
CTCGAGGACGGCTCCGCCTACCAGGGCTACAGCTTCGGCGCCAAGCGCAGCGTCGCCGGCGAGCTCGTCTTCCAG
ACCGGCCTCGTCGGCTACCCCGAGTCGCTGACGGACCCGTCCTACCGCGGCCAGATCCTCGTCATCACCTTCCCC
CTCGTCGGCAACTACGGCGTGCCCGCCCGCGACGCCCTCGACGACCTGTGCCGCGACCTGCCCGCCCACTTCGAG
TCGTCGCAGATCCACGTCGCCGGCCTCGTCACCGCCTCCTACTGCGGCGAGGACTTCTCCCACTTCCTCGCCGCC
TCCTCCCTCGGCGCCTGGCTCAAGGAGCAGGGCGTCCCGGCCGTCTACGGCGTCGACACCCGCGCCCTCACCAAG
AAGATACGCCAGCAGGGCAGCATGCTCGGCCGCATGAGGCTCCAGACGCGCGCCCTGCCCGACGTGCCCCCTCCC
GCCCCCCACGGCCGCGCCCCCGGCGCCCTGCCCGCCGCCTCGCTCGACCACTTTGAGGACATTGCCTGGGCGAAC
CCCAACGAGCAGAATCTCGTGGCCGAGGTCTCCGTCAGGGCCCCGAAGCTCTACAAGCCGCCGCCCTCGGTCTCT
GCCCGCGAGCACCCCTCCGGCCGCACCGTCCGCATCCTCTGCGTCGACGTCGGCATGAAGTACAACCAGCTCCGG
TGCTTCCTCAAGCGCGGCGTCGAGGTCCTGGTCTGCCCCTGGGACCACGACCTGGCCGGCGAGGCGGCCGGCGAG
CGGTACGACGGCCTCTTCATCTCCAACGGGCCCGGCGACCCGGCCGTGCTCGACGCCACCGTCGCCAACATCCGA
GCCGCCATGGACGGCAACAAGACGCCCGTCTTCGGCATCTGCCTCGGCCACCAGCTGCTGGCCAGGGCCGCGGGC
GCCGCGACGGCCAAGATGAAGTTCGGCAACCGCGGCCACAACATCCCCTGCACCAGCATGGTCACCGGCAAGTGC
CACATCACGTCGCAGAACCACGGGTACGCCGTCGAGGCCGGCTCCCTGCCCGCCGGCTGGCGGGAGCTCTTCGTC
AACGCAAACGACGGCAGCAACGAGGGCATCATGCACGTCGGCCGCCCCCACTTCAGCGTCCAGTTCCACCCGGAG
AGCACGCCCGGCCCGCGCGACACCGAGTTCCTGTTCGACGTCTTCGTCGACGCCGTCGTCGCCTGCGCCCGCGAC
CCGGCCCTCCTGCGCCGGCCCGTCAGCTTCCCCGGCGGCACGGTCGAGGAGAACGAGCGGCTGCACCCGCGCGTC
TCGGTCCACAAGGTCCTCGTCCTCGGCAGCGGCGGCCTCAGCATCGGCCAGGCCGGCGAGTTCGACTACTCGGGC
AGCCAGGCCATCAAGGCGCTCAAGGAGGAGGGCATCTACACCGTCCTCATCAACCCCAACATCGCCACCATCCAG
ACGTCCAAGGGCCTGGCCGACAAGGTCTACTTCCTGCCCGTCGACGCCGACTTCGTCCGCAAGGTGATACACTAC
GAGCGCCCGGACGCCATCTACGTCACCTTCGGCGGCCAGACGGCGCTCCAGGTCGGCATCCAGCTCAAGGACGAG
TTCGAGGGGCTCGGCGTCAGGGTGCTGGGCACGCCCATCGACACCATCATCACCACCGAGGACCGCGAGCTCTTC
GCGCGCAGCATGGAGTCCATCGGCGAGAAGTGCGCCAAGTCGGCCTCGGCCAGCAGCGTCGAGGAGGCGCTCGAC
GTGGTCCAGGGCATCGGCTTCCCCGTCATCGTCCGCGCCGCCTACGCGCTCGGCGGCCTGGGCAGCGGCTTCGCC
AACGACGAGCGCGAGCTGCTCGACCTCTGCAACAAGGCCTTCGCCGCCAGCCCGCAGGTGCTGATCGAGCGCAGC
ATGAAGGGCTGGAAGGAGATCGAGTACGAGGTGGTGCGCGACGCCCAGGACAACTGCATCACCGTCTGCAACATG
GAGAACTTCGACCCGCTGGGCATCCACACGGGCGACTCCATCGTCGTCGCCCCGTCGCAGACGCTGTCGGACGAG
GACTACAACATGCTGCGGACGACGGCCGTCAACGTGATCCGCCACCTCGGCGTCGTCGGCGAGTGCAACATCCAG
TACGCCCTCAACCCCTTCTCGCGCGAGTACTGCATCATCGAGGTCAACGCGCGGCTGTCGCGGTCGTCGGCGCTG
GCCTCCAAGGCGACCGGCTACCCGCTGGCCTTCATCGCCGCCAAGCTCGGGCTGGGGATCCCGCTCAAGGAGGTG
TCCAACTCGGTGACGCGGGTGACGTGCGCCTGCTTCGAGCCGTCGCTCGACTACGTCGTCGTCAAGATGCCGCGC
TGGGACCTCAAGAAGTTCACGCGCGTCTCGACCCAGCTGGGCTCGTCGATGAAGAGCGTCGGCGAGGTCATGAGC
ATCGGGCGCTCCTTCGAGGAGGCGATCCAGAAGGCGATCCGGGCCATCGACTTCCACAACCTCGGCTTCGGCGAG
ACGCAGGCGCTGGTGAGCATCGACGACGAGCTGCAGACGCCGTCGGACCAGCGGCTGTTCGCCATCGCCAACGCC
ATGCACGGGGGCTACTCGGTCGACAAGATCTGGGAGATGACCAAGATCGACAAGTGGTTCCTGCGCAAGCTCAAG
GGCCTCAGCGACTTCGCCAAGGACATGGCGCGGCTCACGACGCGCGACGTGGCGCGGTCGCCGGGCCTCATGCTG
CAGGCCAAGCGGCTCGGCTTCTGCGACCGGCAGCTGGCCAAGTTCTGGGACTCGAACGAGATCGCGGTGCGGCGG
CTGCGGCTCGAGGCGGGCGTCAAGCCGTTCGTCAAGCAGATCGACACGGTCGCGGCCGAGTTCCCGGCCTTCACC
AACTACCTGTACCTGACGTACAACGCGTCGGAGCACGACGTCGGCTTCGACGACCACGGCGTCATGGTGCTCGGC
TCGGGCGTGTACCGCATCGGGTCGTCGGTCGAGTTCGACTGGTGCTCGGTGCGGGCGATCCGGACGCTGCGCCGG
TCGGGCTTCAAGACGATCATGGTCAACTACAACCCGGAGACGGTGAGCACCGACTACGACGAGGCCGACAAGCTG
TACTTTGAGAACATCAACCTGGAGACGGTGCTGGACGTGTACCAGCTCGAGGGCGCGAGCGGGGTGCTGGGGGCC
ATGGGCGGGCAGACGCCCAACAACATCGCGCTGCCGCTGCACCGGGCGGGCGTCAAGGTGCTGGGGACGTCGCCC
GAGATGATCGACATGGCGGAGAACCGGTACAAGTTCTCGCGGATGCTGGACCGGATCGAGGTGGACCAGCCGACG
TGGCGGGAGCTGACGAGCTTCGAGGAGGCGCGCGAGTTCTGCCAGGCCGTCGGCTACCCGGTGCTGGTGCGGCCG
TCGTACGTGCTGTCGGGCGCGGCCATGAACACGGTCTACTCGGAGAAGGACCTGGTCAACTACCTGGCGCAGGCG
GCCGAGGTGTCGCGCGAGCACCCGGTCGTCATCTCCAAGTACATTGAGGGGGCCAAGGAGATCGAGATGGACGCG
GTGGCCAAGGACGGCGTGGTGGTGGGCCACTTCATCTCGGAGCACGTGGAGAACGCGGGGGTGCACTCGGGCGAC
GCGACGCTGATCCTGCCGCCGCAGGACCTGGAGGCGACGACGATCGGGCGGATCGAGGAGGCGACGCGCAAGATC
GGGGCGGCGCTCAACGTGACGGGGCCCTTCAACATCCAGTTCATCGCCAAGGACAACGACATCAAGGTGATTGAG
TGCAACGTGCGGGCCTCGCGCTCCTTCCCCTTCGTGTCCAAGGTGATGGGCGTGGACCTGATCGAGATGGCGACG
CGGGCCATCACGGGGCAGCCGTTCCAGGAGTACCCGGCGACGACGCTGGGGCCGGACTGCGTGGGCGTCAAGGTG
CCGCAGTTCAGCTTCTCGCGCCTGTCCGGGGCGGACCCGGTGCTGGGCGTCGAGATGGCGTCGACGGGCGAGGTG
GCCTGCTTCGGCGTCGACAAGTACGAGGCCTACCTCAAGGCGCTGCTGTCGACGGGCTTCCGGATCCCCAAGGCC
AACGTGCTGCTGTCGATCGGGTCCTACAAGGACAAGCGGGAGATGCTGCCGTCGGTGCAGAAGCTGCAGCGGATC
GGCTACAAGCTGTTCGCGACGGCCGGCACGGCCGACTTTTTGCAGGAGCACGGCGTGTCGGTGCAGTTCCTCGAG
GTGCTGGGCCGGGACGAGGACATGAACTCGGAGTTTTCGCTGACGCAGCACCTGGCCAAGAACACCATCGACCTG
TACATCAACCTGCCGTCCAACAACAAGTACCGGCGGCCGGCCAACTACATGAGCCGGGGCTACCAGACGCGGCGC
ATGGCGGTCGACTACCAGATCCCGCTGGTGACCAACGTCAAGAACGCCAAGATCCTGGTCGAGGCCATCGCGCGG
CACGTGTACCTGGACGTACGCCGGAGATGA
Gene >Hirsu2|258
ATGGTCGTCGCAGCACTGCCGCCCGCCGCGGCGCGCATGGCGAGCGTCGAGGACGAGGGCCTCGTCTGCCTCGAG
CTCGAGGACGGCTCCGCCTACCAGGGCTACAGCTTCGGCGCCAAGCGCAGCGTCGCCGGCGAGCTCGTCTTCCAG
ACCGGCCTCGTCGGCTACCCCGAGTCGCTGACGGACCCGTCCTACCGCGGCCAGATCCTCGTCATCACCTTCCCC
CTCGTCGGCAACTACGGCGTGCCCGCCCGCGACGCCCTCGACGACCTGTGCCGCGACCTGCCCGCCCACTTCGAG
TCGTCGCAGATCCACGTCGCCGGCCTCGTCACCGCCTCCTACTGCGGCGAGGACTTCTCCCACTTCCTCGCCGCC
TCCTCCCTCGGCGCCTGGCTCAAGGAGCAGGGCGTCCCGGCCGTCTACGGCGTCGACACCCGCGCCCTCACCAAG
AAGATACGCCAGCAGGGCAGCATGCTCGGCCGCATGAGGCTCCAGACGCGCGCCCTGCCCGACGTGCCCCCTCCC
GCCCCCCACGGCCGCGCCCCCGGCGCCCTGCCCGCCGCCTCGCTCGACCACTTTGAGGACATTGCCTGGGCGAAC
CCCAACGAGCAGAATCTCGTGGCCGAGGGTCCGTCTCTCTTCACTCTCCCACTCTTCACCCCTCTCCTTCTCTTC
CCTTCTTTCTCCAGGGAACGCACGCACACCCTGCTGACCCGCGTGAATGACACACGAATATATAGTCTCCGTCAG
GGCCCCGAAGCTCTACAAGCCGCCGCCCTCGGTCTCTGCCCGCGAGCACCCCTCCGGCCGCACCGTCCGCATCCT
CTGCGTCGACGTCGGCATGAAGTACAACCAGCTCCGGTGCTTCCTCAAGCGCGGCGTCGAGGTCCTGGTCTGCCC
CTGGGACCACGACCTGGCCGGCGAGGCGGCCGGCGAGCGGTACGACGGCCTCTTCATCTCCAACGGGCCCGGCGA
CCCGGCCGTGCTCGACGCCACCGTCGCCAACATCCGAGCCGCCATGGACGGCAACAAGACGCCCGTCTTCGGCAT
CTGCCTCGGCCACCAGCTGCTGGCCAGGGCCGCGGGCGCCGCGACGGCCAAGATGAAGTTCGGCAACCGCGGCCA
CAACATCCCCTGCACCAGCATGGTCACCGGCAAGTGCCACATCACGTCGCAGAACCACGGGTACGCCGTCGAGGC
CGGCTCCCTGCCCGCCGGCTGGCGGGAGCTCTTCGTCAACGCAAACGACGGCAGCAACGAGGGCATCATGCACGT
CGGCCGCCCCCACTTCAGCGTCCAGTTCCACCCGGAGAGCACGCCCGGCCCGCGCGACACCGAGTTCCTGTTCGA
CGTCTTCGTCGACGCCGTCGTCGCCTGCGCCCGCGACCCGGCCCTCCTGCGCCGGCCCGTCAGCTTCCCCGGCGG
CACGGTCGAGGAGAACGAGCGGCTGCACCCGCGCGTCTCGGTCCACAAGGTCCTCGTCCTCGGCAGCGGCGGCCT
CAGCATCGGCCAGGCCGGCGAGTTCGACTACTCGGGCAGCCAGGCCATCAAGGCGCTCAAGGAGGAGGGCATCTA
CACCGTCCTCATCAACCCCAACATCGCCACCATCCAGACGTCCAAGGGCCTGGCCGACAAGGTCTACTTCCTGCC
CGTCGACGCCGACTTCGTCCGCAAGGTGATACACTACGAGCGCCCGGACGCCATCTACGTCACCTTCGGCGGCCA
GACGGCGCTCCAGGTCGGCATCCAGCTCAAGGACGAGTTCGAGGGGCTCGGCGTCAGGGTGCTGGGCACGCCCAT
CGACACCATCATCACCACCGAGGACCGCGAGCTCTTCGCGCGCAGCATGGAGTCCATCGGCGAGAAGTGCGCCAA
GTCGGCCTCGGCCAGCAGCGTCGAGGAGGCGCTCGACGTGGTCCAGGGCATCGGCTTCCCCGTCATCGTCCGCGC
CGCCTACGCGCTCGGCGGCCTGGGCAGCGGCTTCGCCAACGACGAGCGCGAGCTGCTCGACCTCTGCAACAAGGC
CTTCGCCGCCAGCCCGCAGGTGCTGATCGAGCGCAGCATGAAGGGCTGGAAGGAGATCGAGTACGAGGTGGTGCG
CGACGCCCAGGACAACTGCATCACCGTCTGCAACATGGAGAACTTCGACCCGCTGGGCATCCACACGGGCGACTC
CATCGTCGTCGCCCCGTCGCAGACGCTGTCGGACGAGGACTACAACATGCTGCGGACGACGGCCGTCAACGTGAT
CCGCCACCTCGGCGTCGTCGGCGAGTGCAACATCCAGTACGCCCTCAACCCCTTCTCGCGCGAGTACTGCATCAT
CGAGGTCAACGCGCGGCTGTCGCGGTCGTCGGCGCTGGCCTCCAAGGCGACCGGCTACCCGCTGGCCTTCATCGC
CGCCAAGCTCGGGCTGGGGATCCCGCTCAAGGAGGTGTCCAACTCGGTGACGCGGGTGACGTGCGCCTGCTTCGA
GCCGTCGCTCGACTACGTCGTCGTCAAGATGCCGCGCTGGGACCTCAAGAAGTTCACGCGCGTCTCGACCCAGCT
GGGCTCGTCGATGAAGAGCGTCGGCGAGGTCATGAGCATCGGGCGCTCCTTCGAGGAGGCGATCCAGAAGGCGAT
CCGGGCCATCGACTTCCACAACCTCGGCTTCGGCGAGACGCAGGCGCTGGTGAGCATCGACGACGAGCTGCAGAC
GCCGTCGGACCAGCGGCTGTTCGCCATCGCCAACGCCATGCACGGGGGCTACTCGGTCGACAAGATCTGGGAGAT
GACCAAGATCGACAAGTGGTTCCTGCGCAAGCTCAAGGGCCTCAGCGACTTCGCCAAGGACATGGCGCGGCTCAC
GACGCGCGACGTGGCGCGGTCGCCGGGCCTCATGCTGCAGGCCAAGCGGCTCGGCTTCTGCGACCGGCAGCTGGC
CAAGTTCTGGGACTCGAACGAGATCGCGGTGCGGCGGCTGCGGCTCGAGGCGGGCGTCAAGCCGTTCGTCAAGCA
GATCGACACGGTCGCGGCCGAGTTCCCGGCCTTCACCAACTACCTGTACCTGACGTACAACGCGTCGGAGCACGA
CGTCGGCTTCGACGACCACGGCGTCATGGTGCTCGGCTCGGGCGTGTACCGCATCGGGTCGTCGGTCGAGTTCGA
CTGGTGCTCGGTGCGGGCGATCCGGACGCTGCGCCGGTCGGGCTTCAAGACGATCATGGTCAACTACAACCCGGA
GACGGTGAGCACCGACTACGACGAGGCCGACAAGCTGTACTTTGAGAACATCAACCTGGAGACGGTGCTGGACGT
GTACCAGCTCGAGGGCGCGAGCGGGGTGCTGGGGGCCATGGGCGGGCAGACGCCCAACAACATCGCGCTGCCGCT
GCACCGGGCGGGCGTCAAGGTGCTGGGGACGTCGCCCGAGATGATCGACATGGCGGAGAACCGGTACAAGTTCTC
GCGGATGCTGGACCGGATCGAGGTGGACCAGCCGACGTGGCGGGAGCTGACGAGCTTCGAGGAGGCGCGCGAGTT
CTGCCAGGCCGTCGGCTACCCGGTGCTGGTGCGGCCGTCGTACGTGCTGTCGGGCGCGGCCATGAACACGGTCTA
CTCGGAGAAGGACCTGGTCAACTACCTGGCGCAGGCGGCCGAGGTGTCGCGCGAGCACCCGGTCGTCATCTCCAA
GTACATTGAGGGGGCCAAGGAGATCGAGATGGACGCGGTGGCCAAGGACGGCGTGGTGGTGGGCCACTTCATCTC
GGAGCACGTGGAGAACGCGGGGGTGCACTCGGGCGACGCGACGCTGATCCTGCCGCCGCAGGACCTGGAGGCGAC
GACGATCGGGCGGATCGAGGAGGCGACGCGCAAGATCGGGGCGGCGCTCAACGTGACGGGGCCCTTCAACATCCA
GTTCATCGCCAAGGACAACGACATCAAGGTGATTGAGTGCAACGTGCGGGCCTCGCGCTCCTTCCCCTTCGTGTC
CAAGGTGATGGGCGTGGACCTGATCGAGATGGCGACGCGGGCCATCACGGGGCAGCCGTTCCAGGAGTACCCGGC
GACGACGCTGGGGCCGGACTGCGTGGGCGTCAAGGTGCCGCAGTTCAGCTTCTCGCGCCTGTCCGGGGCGGACCC
GGTGCTGGGCGTCGAGATGGCGTCGACGGGCGAGGTGGCCTGCTTCGGCGTCGACAAGTACGAGGCCTACCTCAA
GGCGCTGCTGTCGACGGGCTTCCGGATCCCCAAGGCCAACGTGCTGCTGTCGATCGGGTCCTACAAGGACAAGCG
GGAGATGCTGCCGTCGGTGCAGAAGCTGCAGCGGATCGGCTACAAGCTGTTCGCGACGGCCGGCACGGCCGACTT
TTTGCAGGAGCACGGCGTGTCGGTGCAGTTCCTCGAGGTGCTGGGCCGGGACGAGGACATGAACTCGGAGTTTTC
GCTGACGCAGCACCTGGCCAAGAACACCATCGACCTGTACATCAACCTGCCGTCCAACAACAAGTACCGGCGGCC
GGCCAACTACATGAGCCGGGGCTACCAGACGCGGCGCATGGCGGTCGACTACCAGATCCCGCTGGTGACCAACGT
CAAGAACGCCAAGATCCTGGTCGAGGCCATCGCGCGGCACGTGTACCTGGACGTGTCGAAGCGCGACTTCCAGAT
CACGCGGCAGGAGGCGGAGCAGCCGCCGGCCAAGACGCCGGAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail