Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2572
Gene name
LocationContig_162:4..696
Strand-
Gene length (bp)692
Transcript length (bp)555
Coding sequence length (bp)555
Protein length (aa) 185

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.1E-07 14 67
PF01946 Thi4 Thi4 family 8.7E-07 6 50

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 10 172 2.0E-44
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 11 172 5.0E-42
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 11 172 5.0E-42
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 11 172 5.0E-42
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 11 172 8.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A0R665|ETHA_MYCS2 FAD-containing monooxygenase EthA OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ethA PE=3 SV=1 10 172 2.0E-44
sp|P9WNF9|ETHA_MYCTU FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ethA PE=1 SV=1 11 172 5.0E-42
sp|P9WNF8|ETHA_MYCTO FAD-containing monooxygenase EthA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ethA PE=3 SV=1 11 172 5.0E-42
sp|Q7TVI2|ETHA_MYCBO FAD-containing monooxygenase EthA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ethA PE=1 SV=1 11 172 5.0E-42
sp|Q88J44|BVMO_PSEPK Baeyer-Villiger monooxygenase OS=Pseudomonas putida (strain KT2440) GN=PP_2805 PE=1 SV=1 11 172 8.0E-32
sp|P9WNF7|MYMA_MYCTU Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mymA PE=1 SV=1 10 172 3.0E-30
sp|P9WNF6|MYMA_MYCTO Putative FAD-containing monooxygenase MymA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mymA PE=3 SV=1 10 172 3.0E-30
sp|Q93TJ5|HAPMO_PSEFL 4-hydroxyacetophenone monooxygenase OS=Pseudomonas fluorescens GN=hapE PE=1 SV=1 9 178 3.0E-15
sp|Q47PU3|PAMO_THEFY Phenylacetone monooxygenase OS=Thermobifida fusca (strain YX) GN=pamO PE=1 SV=1 9 172 2.0E-12
sp|Q9RKB5|BVMO2_STRCO Baeyer-Villiger monooxygenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3172 PE=1 SV=1 3 178 1.0E-11
sp|H3JQW0|OTEMO_PSEPU 2-oxo-Delta(3)-4,5,5-trimethylcyclopentenylacetyl-CoA monooxygenase OS=Pseudomonas putida GN=otemo PE=1 SV=1 11 178 4.0E-11
sp|Q00730|STCW_EMENI Putative sterigmatocystin biosynthesis monooxygenase stcW OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcW PE=3 SV=2 12 123 9.0E-11
sp|A7HU16|BVMO_PARL1 Baeyer-Villiger monooxygenase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=Plav_1781 PE=1 SV=1 10 172 1.0E-10
sp|E3VWI7|PNTE_STRAE Pentalenolactone D synthase OS=Streptomyces arenae GN=pntE PE=1 SV=1 2 178 3.0E-10
sp|E3VWK3|PENE_STREX Pentalenolactone D synthase OS=Streptomyces exfoliatus GN=penE PE=1 SV=1 1 178 8.0E-10
sp|P12015|CHMO_ACISP Cyclohexanone 1,2-monooxygenase OS=Acinetobacter sp. PE=1 SV=2 6 178 2.0E-09
sp|P55487|Y4ID_RHISN Uncharacterized monooxygenase y4iD OS=Rhizobium sp. (strain NGR234) GN=NGR_a03290 PE=3 SV=1 10 119 1.0E-07
sp|A3U3H1|BVMO_OCEBH Baeyer-Villiger monooxygenase OS=Oceanicola batsensis (strain ATCC BAA-863 / DSM 15984 / HTCC2597) GN=OB2597_18631 PE=1 SV=1 9 123 2.0E-07
sp|Q8GAW0|CPMO_COMS9 Cyclopentanone 1,2-monooxygenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnB PE=1 SV=3 11 172 8.0E-07
sp|P64746|Y916_MYCBO Uncharacterized monooxygenase Mb0916 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0916 PE=3 SV=1 12 111 4.0E-06
sp|P9WNG1|Y892_MYCTU Uncharacterized monooxygenase Rv0892 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0892 PE=1 SV=1 12 111 4.0E-06
sp|P9WNG0|Y892_MYCTO Uncharacterized monooxygenase MT0916 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0916 PE=3 SV=1 12 111 4.0E-06
sp|A1CLY7|CCSB_ASPCL Ketocytochalasin monooxygenase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsB PE=1 SV=1 4 172 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2572
MESEKEQVDYDVIIVGAGISGINFAYRLKERCPELSYCILEGRNEIGGTWSFFKYPGLRSDSDLNTFGFAWRPWK
QNSPIAEAPQILSYLKEAAAAEGLDRAIRFRHRVESMDWSSSSRTWAVDVAKTAGDDDAAAAERLTLRSRFVLLG
TGYYDYDEPLRTEIPGLDSWAGGASSSSARARRP*
Coding >Hirsu2|2572
ATGGAGAGCGAGAAGGAGCAGGTCGACTACGACGTCATCATTGTCGGGGCCGGCATCTCGGGCATCAACTTCGCC
TACCGGCTGAAGGAGCGCTGCCCGGAGCTCAGCTACTGCATCCTCGAGGGCCGGAATGAGATTGGCGGCACCTGG
AGCTTCTTCAAGTATCCCGGCCTCCGGTCCGACTCGGACCTCAACACCTTCGGCTTCGCCTGGCGGCCGTGGAAG
CAGAACAGCCCGATCGCCGAGGCCCCGCAGATCCTGTCGTACCTCAAGGAGGCGGCCGCGGCCGAGGGCCTGGAC
CGGGCGATCCGGTTCCGGCACCGGGTCGAGAGCATGGACTGGAGCTCGTCGTCGCGCACGTGGGCGGTCGACGTG
GCCAAGACGGCCGGCGACGACGACGCGGCGGCCGCGGAGCGGCTGACGCTGCGGAGCCGCTTCGTCCTGCTCGGG
ACGGGCTACTACGACTACGACGAGCCGCTGCGGACGGAGATTCCGGGCCTGGACTCCTGGGCGGGCGGCGCGTCG
TCATCGTCGGCTCGGGCGCGACGGCCGTGA
Transcript >Hirsu2|2572
ATGGAGAGCGAGAAGGAGCAGGTCGACTACGACGTCATCATTGTCGGGGCCGGCATCTCGGGCATCAACTTCGCC
TACCGGCTGAAGGAGCGCTGCCCGGAGCTCAGCTACTGCATCCTCGAGGGCCGGAATGAGATTGGCGGCACCTGG
AGCTTCTTCAAGTATCCCGGCCTCCGGTCCGACTCGGACCTCAACACCTTCGGCTTCGCCTGGCGGCCGTGGAAG
CAGAACAGCCCGATCGCCGAGGCCCCGCAGATCCTGTCGTACCTCAAGGAGGCGGCCGCGGCCGAGGGCCTGGAC
CGGGCGATCCGGTTCCGGCACCGGGTCGAGAGCATGGACTGGAGCTCGTCGTCGCGCACGTGGGCGGTCGACGTG
GCCAAGACGGCCGGCGACGACGACGCGGCGGCCGCGGAGCGGCTGACGCTGCGGAGCCGCTTCGTCCTGCTCGGG
ACGGGCTACTACGACTACGACGAGCCGCTGCGGACGGAGATTCCGGGCCTGGACTCCTGGGCGGGCGGCGCGTCG
TCATCGTCGGCTCGGGCGCGACGGCCGTGA
Gene >Hirsu2|2572
ATGGAGAGCGAGAAGGAGCAGGTCGACTACGACGTCATCATTGTCGGGGCCGGCATCTCGGGCATCAACTTCGCC
TACCGGCTGAAGGAGCGCTGCCCGGAGCTCAGCTACTGCATCCTCGAGGGCCGGAATGAGATTGGCGGCACCTGG
AGCTTCTTCAAGTATCCCGGTGAGTGAGAGAGCGGGAGAGAGGGAGAGAGACAGAAAGAAGATGGGGGGGGAGGA
CAAAGAAAAACGCTGACAGGCGCACCCCACAGGCCTCCGGTCCGACTCGGACCTCAACACCTTCGGCTTCGCCTG
GCGGCCGTGGAAGCAGAACAGCCCGATCGCCGAGGCCCCGCAGATCCTGTCGTACCTCAAGGAGGCGGCCGCGGC
CGAGGGCCTGGACCGGGCGATCCGGTTCCGGCACCGGGTCGAGAGCATGGACTGGAGCTCGTCGTCGCGCACGTG
GGCGGTCGACGTGGCCAAGACGGCCGGCGACGACGACGCGGCGGCCGCGGAGCGGCTGACGCTGCGGAGCCGCTT
CGTCCTGCTCGGGACGGGCTACTACGACTACGACGAGCCGCTGCGGACGGAGATTCCGGGCCTGGACTCGTTCGC
CGGGCCCGTGGTGCACCCGCAGTTCTGGCCGGCCGGCCTGGAGCTGGGCGGGCGGCGCGTCGTCATCGTCGGCTC
GGGCGCGACGGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail