Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2568
Gene name
LocationContig_1617:1173..2485
Strand-
Gene length (bp)1312
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GMW8|PRM1_CHAGB Plasma membrane fusion protein PRM1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRM1 PE=3 SV=1 1 408 5.0E-137
sp|A1CWM3|PRM1_NEOFI Plasma membrane fusion protein prm1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prm1 PE=3 SV=1 1 399 4.0E-114
sp|B0Y6V2|PRM1_ASPFC Plasma membrane fusion protein prm1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=prm1 PE=3 SV=1 1 399 6.0E-112
sp|Q4WQ14|PRM1_ASPFU Plasma membrane fusion protein prm1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prm1 PE=3 SV=1 1 399 6.0E-112
sp|A1CI53|PRM1_ASPCL Plasma membrane fusion protein prm1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prm1 PE=3 SV=2 1 399 6.0E-111
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2GMW8|PRM1_CHAGB Plasma membrane fusion protein PRM1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRM1 PE=3 SV=1 1 408 5.0E-137
sp|A1CWM3|PRM1_NEOFI Plasma membrane fusion protein prm1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prm1 PE=3 SV=1 1 399 4.0E-114
sp|B0Y6V2|PRM1_ASPFC Plasma membrane fusion protein prm1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=prm1 PE=3 SV=1 1 399 6.0E-112
sp|Q4WQ14|PRM1_ASPFU Plasma membrane fusion protein prm1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prm1 PE=3 SV=1 1 399 6.0E-112
sp|A1CI53|PRM1_ASPCL Plasma membrane fusion protein prm1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prm1 PE=3 SV=2 1 399 6.0E-111
sp|Q1E7G6|PRM1_COCIM Plasma membrane fusion protein PRM1 OS=Coccidioides immitis (strain RS) GN=PRM1 PE=3 SV=1 1 405 4.0E-108
sp|Q2UJS0|PRM1_ASPOR Plasma membrane fusion protein prm1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prm1 PE=3 SV=1 1 399 7.0E-108
sp|Q0CQS4|PRM1_ASPTN Plasma membrane fusion protein prm1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prm1 PE=3 SV=1 1 398 9.0E-108
sp|Q5B1G6|PRM1_EMENI Plasma membrane fusion protein prm1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prm1 PE=3 SV=1 1 399 1.0E-105
sp|A7F9L8|PRM1_SCLS1 Plasma membrane fusion protein prm1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prm1 PE=3 SV=1 1 405 3.0E-105
sp|A6QWA0|PRM1_AJECN Plasma membrane fusion protein PRM1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=PRM1 PE=3 SV=1 1 399 1.0E-103
sp|A6SEV8|PRM1_BOTFB Plasma membrane fusion protein prm1 OS=Botryotinia fuckeliana (strain B05.10) GN=prm1 PE=3 SV=1 1 405 2.0E-101
sp|Q7S130|PRM1_NEUCR Plasma membrane fusion protein prm-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prm-1 PE=3 SV=1 1 408 7.0E-99
sp|A2QJ14|PRM1_ASPNC Plasma membrane fusion protein prm1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prm1 PE=3 SV=1 1 399 2.0E-97
sp|Q6BPF8|PRM1_DEBHA Plasma membrane fusion protein PRM1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRM1 PE=3 SV=2 1 408 1.0E-43
sp|Q6CUV7|PRM1_KLULA Plasma membrane fusion protein PRM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRM1 PE=3 SV=1 2 398 9.0E-40
sp|P53835|PRM1_YEAST Plasma membrane fusion protein PRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM1 PE=1 SV=1 2 408 7.0E-36
sp|A6ZRG6|PRM1_YEAS7 Plasma membrane fusion protein PRM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM1 PE=3 SV=1 2 408 9.0E-36
sp|Q9P771|PRM1_SCHPO Plasma membrane fusion protein prm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prm1 PE=3 SV=1 2 407 3.0E-33
sp|Q6C6L1|PRM1_YARLI Plasma membrane fusion protein PRM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PRM1 PE=3 SV=1 1 408 3.0E-31
sp|Q4P996|PRM1_USTMA Plasma membrane fusion protein PRM1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRM1 PE=3 SV=1 2 408 7.0E-28
sp|A8N5E6|PRM1_COPC7 Plasma membrane fusion protein PRM1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PRM1 PE=3 SV=1 1 408 3.0E-25
sp|Q751Z0|PRM1_ASHGO Plasma membrane fusion protein PRM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRM1 PE=3 SV=1 2 383 7.0E-25
sp|Q59W55|PRM1_CANAL Plasma membrane fusion protein PRM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM1 PE=2 SV=1 9 408 3.0E-19
sp|B0D0P0|PRM1_LACBS Plasma membrane fusion protein PRM1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=PRM1 PE=3 SV=2 1 408 5.0E-19
sp|A3LNK7|PRM1_PICST Plasma membrane fusion protein PRM1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRM1 PE=3 SV=3 1 408 8.0E-19
sp|A7TRZ7|PRM1_VANPO Plasma membrane fusion protein PRM1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRM1 PE=3 SV=1 2 405 2.0E-18
sp|A5DU71|PRM1_LODEL Plasma membrane fusion protein PRM1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRM1 PE=3 SV=1 3 408 3.0E-17
sp|Q6FNX1|PRM1_CANGA Plasma membrane fusion protein PRM1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRM1 PE=3 SV=1 1 394 2.0E-15
sp|A5DJ60|PRM1_PICGU Plasma membrane fusion protein PRM1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRM1 PE=3 SV=2 2 409 1.0E-10
sp|P0CQ05|PRM1_CRYNB Plasma membrane fusion protein PRM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRM1 PE=3 SV=1 1 405 7.0E-10
sp|P0CQ04|PRM1_CRYNJ Plasma membrane fusion protein PRM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRM1 PE=3 SV=1 1 405 9.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22
2 220 242 22
3 297 319 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2568
MPHYLSTGVNDLAASSIEKAVVAMVKGLDLIMLGVQGIIFFYINFLTATYVCLITALIHGSLDVVTSVTEGATKA
FNKIIDGATHEIEDIAGGLEKAINKVTNGIENSIIGHFVPDIPKVDFSEPLENLKKFSLNSDDFVKDVRKLNKDL
PNFDQVQNLTKQAIAIPFDIARKALNEGLGNYRFNRDVFPLAKRQRLTFCSDNDKLEGFFGNLFELVRKARTIFI
VLLSILAAVAMAPMAWLEMRRWRRQQKHAGLIAKNQFDPMDVVYIASRPVTARCGIKASSRLKGRQQVLVRWCVA
YATSAPAIFVLSLAVAGFFSCSCQLIILKAIEKEVPALAGQVGDFAGDVVKALENVSDEWAADANGVVKGLNDDI
NRDVLLYITNATDAVNDTINTFVNTMQEELETVSRACKKG*
Coding >Hirsu2|2568
ATGCCACACTACCTGTCCACCGGTGTCAATGACCTCGCCGCCAGCAGCATTGAAAAGGCTGTGGTTGCCATGGTC
AAGGGGCTGGACCTCATCATGCTTGGTGTTCAGGGTATCATCTTCTTCTATATCAACTTTCTCACAGCCACCTAC
GTCTGCCTTATTACCGCCTTAATCCACGGTAGCCTAGATGTTGTTACATCTGTCACCGAAGGCGCAACCAAGGCC
TTTAACAAAATCATCGATGGGGCGACGCACGAAATCGAGGATATTGCCGGCGGCCTGGAAAAGGCCATAAACAAG
GTAACAAACGGCATCGAAAACTCCATTATTGGCCACTTCGTACCGGATATCCCAAAGGTCGATTTCTCCGAGCCA
CTCGAAAACCTCAAAAAGTTCAGCCTGAATTCAGACGACTTTGTCAAGGATGTCCGGAAATTGAACAAGGACCTC
CCGAATTTCGATCAGGTCCAGAATCTGACGAAACAGGCGATAGCAATTCCGTTCGACATTGCCCGCAAGGCTCTA
AACGAAGGTCTCGGCAACTACAGGTTCAACCGCGACGTGTTTCCACTTGCAAAGCGGCAGAGGCTCACGTTCTGC
TCGGACAATGACAAACTCGAAGGCTTCTTCGGCAATCTTTTTGAACTCGTCCGTAAGGCTCGAACTATCTTCATT
GTCCTGCTATCCATCCTTGCCGCGGTGGCCATGGCGCCAATGGCCTGGCTCGAGATGAGACGGTGGCGGCGGCAA
CAGAAACACGCTGGCTTGATAGCCAAGAACCAATTCGACCCAATGGACGTCGTATACATCGCCTCACGGCCGGTG
ACAGCTCGGTGCGGCATTAAGGCTTCATCCAGGCTCAAGGGCCGACAACAAGTCTTAGTGCGGTGGTGCGTCGCT
TATGCCACGTCGGCGCCGGCAATTTTTGTTCTGTCACTGGCGGTGGCCGGGTTCTTTTCCTGCTCGTGCCAGCTC
ATCATCCTTAAGGCAATTGAGAAAGAGGTCCCTGCACTGGCCGGCCAAGTTGGAGATTTCGCGGGCGACGTTGTC
AAGGCGCTCGAAAACGTGTCTGACGAGTGGGCGGCTGACGCCAACGGCGTCGTCAAGGGACTCAACGACGACATC
AATAGAGACGTTCTTCTGTACATCACAAACGCGACAGATGCCGTCAACGACACCATCAACACATTCGTCAACACC
ATGCAAGAGGAGCTCGAAACAGTATCGAGAGCGTGCAAAAAGGGCTGA
Transcript >Hirsu2|2568
ATGCCACACTACCTGTCCACCGGTGTCAATGACCTCGCCGCCAGCAGCATTGAAAAGGCTGTGGTTGCCATGGTC
AAGGGGCTGGACCTCATCATGCTTGGTGTTCAGGGTATCATCTTCTTCTATATCAACTTTCTCACAGCCACCTAC
GTCTGCCTTATTACCGCCTTAATCCACGGTAGCCTAGATGTTGTTACATCTGTCACCGAAGGCGCAACCAAGGCC
TTTAACAAAATCATCGATGGGGCGACGCACGAAATCGAGGATATTGCCGGCGGCCTGGAAAAGGCCATAAACAAG
GTAACAAACGGCATCGAAAACTCCATTATTGGCCACTTCGTACCGGATATCCCAAAGGTCGATTTCTCCGAGCCA
CTCGAAAACCTCAAAAAGTTCAGCCTGAATTCAGACGACTTTGTCAAGGATGTCCGGAAATTGAACAAGGACCTC
CCGAATTTCGATCAGGTCCAGAATCTGACGAAACAGGCGATAGCAATTCCGTTCGACATTGCCCGCAAGGCTCTA
AACGAAGGTCTCGGCAACTACAGGTTCAACCGCGACGTGTTTCCACTTGCAAAGCGGCAGAGGCTCACGTTCTGC
TCGGACAATGACAAACTCGAAGGCTTCTTCGGCAATCTTTTTGAACTCGTCCGTAAGGCTCGAACTATCTTCATT
GTCCTGCTATCCATCCTTGCCGCGGTGGCCATGGCGCCAATGGCCTGGCTCGAGATGAGACGGTGGCGGCGGCAA
CAGAAACACGCTGGCTTGATAGCCAAGAACCAATTCGACCCAATGGACGTCGTATACATCGCCTCACGGCCGGTG
ACAGCTCGGTGCGGCATTAAGGCTTCATCCAGGCTCAAGGGCCGACAACAAGTCTTAGTGCGGTGGTGCGTCGCT
TATGCCACGTCGGCGCCGGCAATTTTTGTTCTGTCACTGGCGGTGGCCGGGTTCTTTTCCTGCTCGTGCCAGCTC
ATCATCCTTAAGGCAATTGAGAAAGAGGTCCCTGCACTGGCCGGCCAAGTTGGAGATTTCGCGGGCGACGTTGTC
AAGGCGCTCGAAAACGTGTCTGACGAGTGGGCGGCTGACGCCAACGGCGTCGTCAAGGGACTCAACGACGACATC
AATAGAGACGTTCTTCTGTACATCACAAACGCGACAGATGCCGTCAACGACACCATCAACACATTCGTCAACACC
ATGCAAGAGGAGCTCGAAACAGTATCGAGAGCGTGCAAAAAGGGCTGA
Gene >Hirsu2|2568
ATGCCACACTACCTGTCCACCGGTGTCAATGACCTCGCCGCCAGCAGCATTGAAAAGGCTGTGGTTGCCATGGTC
AAGGGGCTGGACCTCATCATGCTTGGTGTTCAGGGTATCATCTTCTTCTATATCAACTTTCTCACAGCCACCTAC
GTCTGCCTTATTACCGCCTTAATCCACGGTAGCCTAGATGTTGTTACATCTGTCACCGAAGGCGCAACCAAGGCC
TTTAACAAAATCATCGATGGGGCGACGCACGAAATCGAGGATATTGCCGGCGGCCTGGAAAAGGCCATAAACAAG
GTAACAAACGGCATCGAAAACTCCATTATTGGCCACTTCGTACCGGATATCCCAAAGGTCGATTTCTCCGAGCCA
CTCGAAAACCTCAAAAAGTTCAGCCTGAATTCAGACGACTTTGTCAAGGATGTCCGGAAATTGAACAAGGACCTC
CCGAATTTCGATCAGGTCCAGAATCTGACGAAACAGGCGATAGCAATTCCGTTCGACATTGCCCGCAAGGCTCTA
AACGAAGGTCTCGGCAACTACAGGTTCAACCGCGACGTGTTTCCACTTGCAAAGCGGCAGAGGCTCACGTTCTGC
TCGGACAATGACAAACTCGAAGGCTTCTTCGGCAATCTTTTTGAACTCGTCCGTAAGGCTCGAACTATCTTCATT
GTCCTGCTATCCATCCTTGCCGCGGTGGCCATGGCGCCAATGGCCTGGCTCGAGATGAGACGGTGGCGGCGGCAA
CAGAAACACGCTGGCTTGATAGCCAAGAACCAATTCGACCCAATGGACGTCGTATACATCGCCTCACGGCCGGTG
ACAGCTCGGTGCGGCATTAAGGCTTCATCCAGGCTCAAGGGCCGACAACAAGTCTTAGTGCGGTGGTGCGTCGCT
TATGCCACGTCGGCGCCGGCAATTTTTGTTCTGTCACTGGCGGTGGCCGGGTTCTTTTCCTGCTCGTGCCAGCTC
ATCATCCTTAAGGCAATTGAGAAAGAGGTCCCTGCACTGGCCGGCCAAGTTGGAGATTTCGCGGGCGACGTTGTC
AAGGCGCTCGAAAACGTGTCTGACGAGTGGGCGGCTGACGCCAACGGCGTCGTCAAGGGACTCAACGACGACATC
AATAGAGACGTTCTTCTGTACATCACAAACGCGACAGATGCCGTCAACGACACCATCAACACATTCGTCAACACC
ATGCAAGAGGAGCTCGAAACAGTGTTCAATGGAACGATACTGCTGGCACCAATTAAGTCCGTGCTGCATTGCGTA
ATTGGAATCAAGATCGAGAGCGTGCAAAAAGGGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail