Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2565
Gene name
LocationContig_1616:387..1395
Strand+
Gene length (bp)1008
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04893 Yip1 Yip1 domain 3.4E-11 76 231

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD3|YIP5_SCHPO Protein YIP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip5 PE=3 SV=1 10 261 9.0E-42
sp|Q6P6G5|YIPF1_RAT Protein YIPF1 OS=Rattus norvegicus GN=Yipf1 PE=2 SV=1 16 260 2.0E-31
sp|Q9Y548|YIPF1_HUMAN Protein YIPF1 OS=Homo sapiens GN=YIPF1 PE=1 SV=1 54 260 4.0E-31
sp|Q91VU1|YIPF1_MOUSE Protein YIPF1 OS=Mus musculus GN=Yipf1 PE=2 SV=1 16 260 8.0E-31
sp|Q5RBL0|YIPF1_PONAB Protein YIPF1 OS=Pongo abelii GN=YIPF1 PE=2 SV=1 54 260 1.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UTD3|YIP5_SCHPO Protein YIP5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yip5 PE=3 SV=1 10 261 9.0E-42
sp|Q6P6G5|YIPF1_RAT Protein YIPF1 OS=Rattus norvegicus GN=Yipf1 PE=2 SV=1 16 260 2.0E-31
sp|Q9Y548|YIPF1_HUMAN Protein YIPF1 OS=Homo sapiens GN=YIPF1 PE=1 SV=1 54 260 4.0E-31
sp|Q91VU1|YIPF1_MOUSE Protein YIPF1 OS=Mus musculus GN=Yipf1 PE=2 SV=1 16 260 8.0E-31
sp|Q5RBL0|YIPF1_PONAB Protein YIPF1 OS=Pongo abelii GN=YIPF1 PE=2 SV=1 54 260 1.0E-30
sp|Q54TS4|YIPF1_DICDI Protein YIPF1 homolog OS=Dictyostelium discoideum GN=yipf1 PE=3 SV=1 43 264 6.0E-27
sp|Q99LP8|YIPF2_MOUSE Protein YIPF2 OS=Mus musculus GN=Yipf2 PE=2 SV=1 57 260 3.0E-26
sp|Q9BWQ6|YIPF2_HUMAN Protein YIPF2 OS=Homo sapiens GN=YIPF2 PE=1 SV=1 65 270 6.0E-25
sp|Q5XIT3|YIPF2_RAT Protein YIPF2 OS=Rattus norvegicus GN=Yipf2 PE=2 SV=1 32 260 2.0E-22
sp|P53108|YIP5_YEAST Protein YIP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIP5 PE=1 SV=1 68 260 4.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 145 167 22
3 180 199 19
4 204 226 22
5 239 261 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2565
MSGSGYDAVVDVDDEGDLGHTDLQEDLEFHHSNFGESAAGNHKGRLPSGLPPPATTSSSSPKRLLWSLSFYAQFF
DVDTSAVLSRCGAALFPCANFLDVLEGNPDLYGPFWIATTVVLILFLGGTISQYLSTTKSVPFAYDFRLLSGAAG
LVYGYTLFIPISLFVALRYFGSESANLLECWALYGYSNLIWIPVAIISWSPIEILNWVFVAVGFGLSVVFLVRNL
YPVLSATDRQVSKVLLILVVLLHAGLSLTIKILFFAHGSPVARAPGEGGPDSQKSNKPPARH*
Coding >Hirsu2|2565
ATGTCTGGATCCGGATACGACGCGGTGGTAGATGTGGACGACGAGGGAGACCTCGGCCACACGGACCTGCAGGAG
GACCTCGAATTCCATCACTCCAACTTCGGCGAGTCTGCGGCGGGAAACCACAAAGGCCGGCTTCCCTCTGGTCTC
CCGCCGCCCGCGACGACATCGTCCTCGTCGCCGAAACGCTTGCTATGGTCACTATCATTCTATGCACAGTTCTTC
GACGTGGACACATCAGCAGTCCTGTCGCGCTGCGGGGCCGCCCTCTTCCCATGTGCAAACTTCCTAGACGTGCTG
GAGGGCAATCCCGATCTCTACGGTCCCTTTTGGATCGCGACGACAGTGGTCTTGATCTTGTTCCTCGGCGGCACA
ATCAGCCAGTATCTATCAACGACAAAGTCTGTGCCTTTCGCGTACGACTTTCGGCTGCTGAGTGGCGCCGCTGGA
CTCGTCTACGGATACACACTCTTCATACCAATTTCATTGTTCGTCGCCCTCCGGTACTTTGGCAGCGAATCAGCC
AACCTGCTTGAGTGTTGGGCCTTGTACGGTTATTCAAACCTAATCTGGATCCCGGTTGCCATTATCAGTTGGTCG
CCGATCGAGATCCTCAATTGGGTGTTCGTGGCCGTCGGCTTCGGCCTCTCCGTCGTCTTCCTTGTCCGCAACCTG
TATCCAGTTCTGAGTGCGACCGATCGCCAAGTCAGCAAGGTGCTTCTCATACTCGTGGTGCTACTCCACGCTGGA
CTATCACTCACCATCAAGATACTGTTTTTTGCTCATGGCAGTCCCGTGGCACGGGCGCCGGGCGAAGGCGGACCC
GACAGCCAGAAGAGCAACAAACCGCCAGCCAGGCACTAG
Transcript >Hirsu2|2565
ATGTCTGGATCCGGATACGACGCGGTGGTAGATGTGGACGACGAGGGAGACCTCGGCCACACGGACCTGCAGGAG
GACCTCGAATTCCATCACTCCAACTTCGGCGAGTCTGCGGCGGGAAACCACAAAGGCCGGCTTCCCTCTGGTCTC
CCGCCGCCCGCGACGACATCGTCCTCGTCGCCGAAACGCTTGCTATGGTCACTATCATTCTATGCACAGTTCTTC
GACGTGGACACATCAGCAGTCCTGTCGCGCTGCGGGGCCGCCCTCTTCCCATGTGCAAACTTCCTAGACGTGCTG
GAGGGCAATCCCGATCTCTACGGTCCCTTTTGGATCGCGACGACAGTGGTCTTGATCTTGTTCCTCGGCGGCACA
ATCAGCCAGTATCTATCAACGACAAAGTCTGTGCCTTTCGCGTACGACTTTCGGCTGCTGAGTGGCGCCGCTGGA
CTCGTCTACGGATACACACTCTTCATACCAATTTCATTGTTCGTCGCCCTCCGGTACTTTGGCAGCGAATCAGCC
AACCTGCTTGAGTGTTGGGCCTTGTACGGTTATTCAAACCTAATCTGGATCCCGGTTGCCATTATCAGTTGGTCG
CCGATCGAGATCCTCAATTGGGTGTTCGTGGCCGTCGGCTTCGGCCTCTCCGTCGTCTTCCTTGTCCGCAACCTG
TATCCAGTTCTGAGTGCGACCGATCGCCAAGTCAGCAAGGTGCTTCTCATACTCGTGGTGCTACTCCACGCTGGA
CTATCACTCACCATCAAGATACTGTTTTTTGCTCATGGCAGTCCCGTGGCACGGGCGCCGGGCGAAGGCGGACCC
GACAGCCAGAAGAGCAACAAACCGCCAGCCAGGCACTAG
Gene >Hirsu2|2565
ATGTCTGGATCCGGATACGACGCGGTGGTAGATGTGGACGACGAGGTAGGCGGTGGTGAAGTTCGCGGGGAACGC
TGCTAAGCGATGTGCCAGGGAGACCTCGGCCACACGGACCTGCAGGAGGACCTCGAATTCCATCACTCCAACTTC
GGCGAGTCTGCGGCGGGAAACCACAAAGGCCGGCTTCCCTCTGGTCTCCCGCCGCCCGCGACGACATCGTCCTCG
TCGCCGAAACGCTTGCTATGGTCACTATCATTCTATGCACAGTTCTTCGACGTGGACACATCAGCAGTCCTGTCG
CGCTGCGGGGCCGCCCTCTTCCCATGTGCAAACTTCCTAGACGTGCTGGAGGGCAATCCCGATCTCTACGGTCCC
TTTTGGATCGCGACGACAGTGGTCTTGATCTTGTTCCTCGGCGGCACAATCAGCCAGTATCTATCAACGACAAAG
TCTGTGCCTTTCGCGTACGACTTTCGGCTGCTGAGTGGTAGGAAGCGAGACCCCTTCTCCCCTCCGTCCCTCCTC
TCGTCAAATCCGATGGATATTGAGTGTCTGAGGTGGCTGACTCGCGTGGGCCGGGAAGGCGCCGCTGGACTCGTC
TACGGATACACACTCTTCATACCAATTTCATTGTTCGTCGCCCTCCGGTACTTTGGCAGCGAATCAGCCAACCTG
CTTGAGTGTTGGGCCTTGTACGGTTATTCAAACCTAATCTGGATCCCGGTTGCCATTATCAGTTGGTCGCCGATC
GAGATCCTCAATTGGGTGTTCGTGGCCGTCGGCTTCGGCCTCTCCGTCGTCTTCCTTGTCCGCAACCTGTATCCA
GTTCTGAGTGCGACCGATCGCCAAGTCAGCAAGGTGCTTCTCATACTCGTGGTGCTACTCCACGCTGGACTATCA
CTCACCATCAAGATACTGTTTTTTGCTCATGGCAGTCCCGTGGCACGGGCGCCGGGCGAAGGCGGACCCGACAGC
CAGAAGAGCAACAAACCGCCAGCCAGGCACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail