Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2561
Gene name
LocationContig_1612:2817..4263
Strand+
Gene length (bp)1446
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 3.0E-16 129 264
PF02469 Fasciclin Fasciclin domain 1.5E-24 278 426

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P74615|Y1483_SYNY3 Uncharacterized protein sll1483 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1483 PE=3 SV=1 118 266 5.0E-09
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 188 446 1.0E-07
sp|O11780|BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa GN=TGFBI PE=1 SV=1 148 446 6.0E-07
sp|P74615|Y1483_SYNY3 Uncharacterized protein sll1483 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1483 PE=3 SV=1 279 428 4.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0921 0.0388 0.8985 0.0774 0.0861 0.0376 0.4021 0.1186 0.1815 0.0024

SignalP

SignalP signal predicted Location Score
Yes 1 - 15 0.619721

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2136
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1378
Ophiocordyceps australis map64 (Brazil) OphauB2|702
Ophiocordyceps camponoti-floridani Ophcf2|00008
Ophiocordyceps camponoti-rufipedis Ophun1|6473
Ophiocordyceps kimflemingae Ophio5|4444
Ophiocordyceps subramaniannii Hirsu2|2561 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2561
MRLVLTALAAAALSGAIVVPDRLPAVLNKQQVPLSGPSPADGETAPLPSDDDAAPAGFPAAKVESLVRLAADRVA
ELVDSTLESVQDAVQDAGHDQLSSGLSDALAGGRHGDKRPHRTIYELIRGCKHTSRFAAAVDEHPDIVKLLNSSH
ARHTLFVPTDEAFRRLPGHHGDGDGGGEHKVGKEFVEHVLRYHIGVGDYPAGRILHTHTLPTALDEESLGGEPQR
LRTSIGLGGVELNFYSKVVAANIEASNGIIHAVNHVLVPPFMVGRLLTLFPSRFSTLLLAYEKTDFVDFIHKVSL
VGSTVFAPSNDAFGRLGARANAFLFNTQTGHKYLRALLKYHVSPNATLYSDAYYDKTDGGSGAGGRGLRREHYDL
PTLLGDARVAVDKVKLGPFSVVRVNGFAHVAVRDAVAKNGVIQVLDQVLVPPCKHRKRSGADDKAGGEMEVEELK
ERLAAYV*
Coding >Hirsu2|2561
ATGAGACTCGTCCTTACCGCCTTGGCAGCCGCCGCCCTCTCCGGGGCCATCGTCGTCCCGGACCGCCTCCCAGCC
GTGCTCAACAAGCAGCAGGTCCCGCTGTCCGGACCGTCCCCGGCGGACGGTGAGACAGCCCCGCTCCCGTCCGAC
GACGATGCCGCCCCGGCCGGCTTCCCGGCGGCCAAGGTCGAGTCCCTCGTCCGGCTCGCGGCGGACCGCGTGGCC
GAGCTCGTCGACAGCACCCTCGAGTCCGTCCAGGACGCCGTCCAGGACGCCGGCCACGACCAGCTCTCGTCCGGC
CTCTCCGATGCCCTCGCCGGCGGGCGGCACGGCGACAAGCGGCCGCACCGGACCATCTACGAGCTCATCCGCGGC
TGCAAGCACACGTCCCGCTTCGCCGCCGCGGTCGACGAGCACCCCGACATCGTGAAGCTGCTCAACAGCAGCCAC
GCCCGCCACACCCTCTTCGTTCCCACCGACGAGGCCTTCCGGCGGCTCCCCGGCCATCACGGCGACGGCGACGGC
GGCGGCGAGCACAAGGTCGGCAAGGAATTCGTCGAGCACGTCCTGCGCTACCACATCGGAGTCGGCGACTACCCG
GCCGGCCGCATCCTCCACACGCACACGCTGCCGACGGCCCTGGACGAGGAGTCGCTCGGCGGCGAGCCCCAGCGG
CTGCGGACCAGCATCGGCCTCGGCGGCGTCGAGCTCAACTTCTACAGCAAGGTGGTTGCCGCCAACATCGAGGCA
TCCAACGGCATCATCCACGCCGTCAACCACGTGCTCGTGCCGCCCTTCATGGTCGGCCGCCTGCTCACCCTGTTC
CCGAGCCGGTTCTCGACGCTGCTGCTGGCGTACGAGAAGACGGACTTTGTCGACTTCATCCACAAGGTCAGCTTG
GTCGGCAGTACCGTCTTCGCGCCCAGCAACGACGCCTTCGGCCGGCTGGGCGCCCGGGCCAACGCCTTCCTCTTC
AACACGCAGACGGGCCACAAGTACCTGCGCGCCCTGCTCAAGTACCACGTCTCGCCTAACGCGACGCTGTACAGC
GACGCCTACTACGACAAGACGGACGGCGGCTCCGGCGCCGGCGGCCGCGGCCTGAGGCGGGAGCACTACGACCTG
CCGACGCTGCTCGGCGACGCCCGCGTGGCCGTCGACAAGGTCAAGCTGGGCCCCTTCTCCGTCGTGCGCGTCAAC
GGCTTCGCCCACGTGGCGGTGCGCGACGCCGTGGCCAAGAACGGCGTGATTCAGGTGCTGGACCAGGTGTTGGTG
CCGCCGTGTAAGCACCGGAAGCGGTCCGGGGCCGACGATAAGGCCGGCGGCGAGATGGAGGTGGAGGAGCTCAAG
GAGAGGCTGGCGGCGTACGTGTAA
Transcript >Hirsu2|2561
ATGAGACTCGTCCTTACCGCCTTGGCAGCCGCCGCCCTCTCCGGGGCCATCGTCGTCCCGGACCGCCTCCCAGCC
GTGCTCAACAAGCAGCAGGTCCCGCTGTCCGGACCGTCCCCGGCGGACGGTGAGACAGCCCCGCTCCCGTCCGAC
GACGATGCCGCCCCGGCCGGCTTCCCGGCGGCCAAGGTCGAGTCCCTCGTCCGGCTCGCGGCGGACCGCGTGGCC
GAGCTCGTCGACAGCACCCTCGAGTCCGTCCAGGACGCCGTCCAGGACGCCGGCCACGACCAGCTCTCGTCCGGC
CTCTCCGATGCCCTCGCCGGCGGGCGGCACGGCGACAAGCGGCCGCACCGGACCATCTACGAGCTCATCCGCGGC
TGCAAGCACACGTCCCGCTTCGCCGCCGCGGTCGACGAGCACCCCGACATCGTGAAGCTGCTCAACAGCAGCCAC
GCCCGCCACACCCTCTTCGTTCCCACCGACGAGGCCTTCCGGCGGCTCCCCGGCCATCACGGCGACGGCGACGGC
GGCGGCGAGCACAAGGTCGGCAAGGAATTCGTCGAGCACGTCCTGCGCTACCACATCGGAGTCGGCGACTACCCG
GCCGGCCGCATCCTCCACACGCACACGCTGCCGACGGCCCTGGACGAGGAGTCGCTCGGCGGCGAGCCCCAGCGG
CTGCGGACCAGCATCGGCCTCGGCGGCGTCGAGCTCAACTTCTACAGCAAGGTGGTTGCCGCCAACATCGAGGCA
TCCAACGGCATCATCCACGCCGTCAACCACGTGCTCGTGCCGCCCTTCATGGTCGGCCGCCTGCTCACCCTGTTC
CCGAGCCGGTTCTCGACGCTGCTGCTGGCGTACGAGAAGACGGACTTTGTCGACTTCATCCACAAGGTCAGCTTG
GTCGGCAGTACCGTCTTCGCGCCCAGCAACGACGCCTTCGGCCGGCTGGGCGCCCGGGCCAACGCCTTCCTCTTC
AACACGCAGACGGGCCACAAGTACCTGCGCGCCCTGCTCAAGTACCACGTCTCGCCTAACGCGACGCTGTACAGC
GACGCCTACTACGACAAGACGGACGGCGGCTCCGGCGCCGGCGGCCGCGGCCTGAGGCGGGAGCACTACGACCTG
CCGACGCTGCTCGGCGACGCCCGCGTGGCCGTCGACAAGGTCAAGCTGGGCCCCTTCTCCGTCGTGCGCGTCAAC
GGCTTCGCCCACGTGGCGGTGCGCGACGCCGTGGCCAAGAACGGCGTGATTCAGGTGCTGGACCAGGTGTTGGTG
CCGCCGTGTAAGCACCGGAAGCGGTCCGGGGCCGACGATAAGGCCGGCGGCGAGATGGAGGTGGAGGAGCTCAAG
GAGAGGCTGGCGGCGTACGTGTAA
Gene >Hirsu2|2561
ATGAGACTCGTCCTTACCGCCTTGGCAGCCGCCGCCCTCTCCGGGGCCATCGTCGTCCCGGACCGCCTCCCAGCC
GTGCTCAACAAGCAGCAGGTCCCGCTGTCCGGACCGTCCCCGGCGGACGGTGAGACAGCCCCGCTCCCGTCCGAC
GACGATGCCGCCCCGGCCGGCTTCCCGGCGGCCAAGGTCGAGTCCCTCGTCCGGCTCGCGGCGGACCGCGTGGCC
GAGCTCGTCGACAGCACCCTCGAGTCCGTCCAGGACGCCGTCCAGGACGCCGGCCACGACCAGCTCTCGTCCGGC
CTCTCCGATGCCCTCGCCGGCGGGCGGCACGGCGACAAGCGGCCGCACCGGACCATCTACGAGCTCATCCGCGGC
TGCAAGCACACGTCCCGCTTCGCCGCCGCGGTCGACGAGCACCCCGACATCGTGAAGCTGCTCAACAGCAGCCAC
GCCCGCCACACCCTCTTCGTTCCCACCGACGAGGCCTTCCGGCGGCTCCCCGGCCATCACGGCGACGGCGACGGC
GGCGGCGAGCACAAGGTCGGCAAGGAATTCGTCGAGCACGTCCTGCGCTACCACATCGGAGTCGGCGACTACCCG
GCCGGCCGCATCCTCCACACGCACACGCTGCCGACGGCCCTGGACGAGGAGTCGCTCGGCGGCGAGCCCCAGCGG
CTGCGGACCAGCATCGGCCTCGGCGGCGTCGAGCTCAACTTCTACAGCAAGGTGGTTGCCGCCAACATCGTGAGC
CTTGCCATCCCCCTCCTCTCCCCTAACTTGGTCGCTGGCGAGCCGCTGCTGACGGTGGCGGAACAGGAGGCATCC
AACGGCATCATCCACGCCGTCAACCACGTGCTCGTGCCGCCCTTCATGGTCGGCCGCCTGCTCACCCTGTTCCCG
AGCCGGTTCTCGACGCTGCTGCTGGCGTACGAGAAGACGGACTTTGTCGACTTCATCCACAAGGTCAGCTTGGTC
GGCAGTACCGTCTTCGCGCCCAGCAACGACGCCTTCGGCCGGCTGGGCGCCCGGGCCAACGCCTTCCTCTTCAAC
ACGCAGACGGGCCACAAGTACCTGCGCGCCCTGCTCAAGTACCACGTCTCGCCTAACGCGACGCTGTACAGCGAC
GCCTACTACGACAAGACGGACGGCGGCTCCGGCGCCGGCGGCCGCGGCCTGAGGCGGGAGCACTACGACCTGCCG
ACGCTGCTCGGCGACGCCCGCGTGGCCGTCGACAAGGTCAAGCTGGGCCCCTTCTCCGTCGTGCGCGTCAACGGC
TTCGCCCACGTGGCGGTGCGCGACGCCGTGGCCAAGAACGGCGTGATTCAGGTGCTGGACCAGGTGTTGGTGCCG
CCGTGTAAGCACCGGAAGCGGTCCGGGGCCGACGATAAGGCCGGCGGCGAGATGGAGGTGGAGGAGCTCAAGGAG
AGGCTGGCGGCGTACGTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail