Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2561
Gene name
LocationContig_1612:2817..4263
Strand+
Gene length (bp)1446
Transcript length (bp)1374
Coding sequence length (bp)1374
Protein length (aa) 458

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 3.0E-16 129 264
PF02469 Fasciclin Fasciclin domain 1.5E-24 278 426

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P74615|Y1483_SYNY3 Uncharacterized protein sll1483 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1483 PE=3 SV=1 118 266 5.0E-09
sp|Q15582|BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens GN=TGFBI PE=1 SV=1 188 446 1.0E-07
sp|O11780|BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa GN=TGFBI PE=1 SV=1 148 446 6.0E-07
sp|P74615|Y1483_SYNY3 Uncharacterized protein sll1483 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1483 PE=3 SV=1 279 428 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2561
MRLVLTALAAAALSGAIVVPDRLPAVLNKQQVPLSGPSPADGETAPLPSDDDAAPAGFPAAKVESLVRLAADRVA
ELVDSTLESVQDAVQDAGHDQLSSGLSDALAGGRHGDKRPHRTIYELIRGCKHTSRFAAAVDEHPDIVKLLNSSH
ARHTLFVPTDEAFRRLPGHHGDGDGGGEHKVGKEFVEHVLRYHIGVGDYPAGRILHTHTLPTALDEESLGGEPQR
LRTSIGLGGVELNFYSKVVAANIEASNGIIHAVNHVLVPPFMVGRLLTLFPSRFSTLLLAYEKTDFVDFIHKVSL
VGSTVFAPSNDAFGRLGARANAFLFNTQTGHKYLRALLKYHVSPNATLYSDAYYDKTDGGSGAGGRGLRREHYDL
PTLLGDARVAVDKVKLGPFSVVRVNGFAHVAVRDAVAKNGVIQVLDQVLVPPCKHRKRSGADDKAGGEMEVEELK
ERLAAYV*
Coding >Hirsu2|2561
ATGAGACTCGTCCTTACCGCCTTGGCAGCCGCCGCCCTCTCCGGGGCCATCGTCGTCCCGGACCGCCTCCCAGCC
GTGCTCAACAAGCAGCAGGTCCCGCTGTCCGGACCGTCCCCGGCGGACGGTGAGACAGCCCCGCTCCCGTCCGAC
GACGATGCCGCCCCGGCCGGCTTCCCGGCGGCCAAGGTCGAGTCCCTCGTCCGGCTCGCGGCGGACCGCGTGGCC
GAGCTCGTCGACAGCACCCTCGAGTCCGTCCAGGACGCCGTCCAGGACGCCGGCCACGACCAGCTCTCGTCCGGC
CTCTCCGATGCCCTCGCCGGCGGGCGGCACGGCGACAAGCGGCCGCACCGGACCATCTACGAGCTCATCCGCGGC
TGCAAGCACACGTCCCGCTTCGCCGCCGCGGTCGACGAGCACCCCGACATCGTGAAGCTGCTCAACAGCAGCCAC
GCCCGCCACACCCTCTTCGTTCCCACCGACGAGGCCTTCCGGCGGCTCCCCGGCCATCACGGCGACGGCGACGGC
GGCGGCGAGCACAAGGTCGGCAAGGAATTCGTCGAGCACGTCCTGCGCTACCACATCGGAGTCGGCGACTACCCG
GCCGGCCGCATCCTCCACACGCACACGCTGCCGACGGCCCTGGACGAGGAGTCGCTCGGCGGCGAGCCCCAGCGG
CTGCGGACCAGCATCGGCCTCGGCGGCGTCGAGCTCAACTTCTACAGCAAGGTGGTTGCCGCCAACATCGAGGCA
TCCAACGGCATCATCCACGCCGTCAACCACGTGCTCGTGCCGCCCTTCATGGTCGGCCGCCTGCTCACCCTGTTC
CCGAGCCGGTTCTCGACGCTGCTGCTGGCGTACGAGAAGACGGACTTTGTCGACTTCATCCACAAGGTCAGCTTG
GTCGGCAGTACCGTCTTCGCGCCCAGCAACGACGCCTTCGGCCGGCTGGGCGCCCGGGCCAACGCCTTCCTCTTC
AACACGCAGACGGGCCACAAGTACCTGCGCGCCCTGCTCAAGTACCACGTCTCGCCTAACGCGACGCTGTACAGC
GACGCCTACTACGACAAGACGGACGGCGGCTCCGGCGCCGGCGGCCGCGGCCTGAGGCGGGAGCACTACGACCTG
CCGACGCTGCTCGGCGACGCCCGCGTGGCCGTCGACAAGGTCAAGCTGGGCCCCTTCTCCGTCGTGCGCGTCAAC
GGCTTCGCCCACGTGGCGGTGCGCGACGCCGTGGCCAAGAACGGCGTGATTCAGGTGCTGGACCAGGTGTTGGTG
CCGCCGTGTAAGCACCGGAAGCGGTCCGGGGCCGACGATAAGGCCGGCGGCGAGATGGAGGTGGAGGAGCTCAAG
GAGAGGCTGGCGGCGTACGTGTAA
Transcript >Hirsu2|2561
ATGAGACTCGTCCTTACCGCCTTGGCAGCCGCCGCCCTCTCCGGGGCCATCGTCGTCCCGGACCGCCTCCCAGCC
GTGCTCAACAAGCAGCAGGTCCCGCTGTCCGGACCGTCCCCGGCGGACGGTGAGACAGCCCCGCTCCCGTCCGAC
GACGATGCCGCCCCGGCCGGCTTCCCGGCGGCCAAGGTCGAGTCCCTCGTCCGGCTCGCGGCGGACCGCGTGGCC
GAGCTCGTCGACAGCACCCTCGAGTCCGTCCAGGACGCCGTCCAGGACGCCGGCCACGACCAGCTCTCGTCCGGC
CTCTCCGATGCCCTCGCCGGCGGGCGGCACGGCGACAAGCGGCCGCACCGGACCATCTACGAGCTCATCCGCGGC
TGCAAGCACACGTCCCGCTTCGCCGCCGCGGTCGACGAGCACCCCGACATCGTGAAGCTGCTCAACAGCAGCCAC
GCCCGCCACACCCTCTTCGTTCCCACCGACGAGGCCTTCCGGCGGCTCCCCGGCCATCACGGCGACGGCGACGGC
GGCGGCGAGCACAAGGTCGGCAAGGAATTCGTCGAGCACGTCCTGCGCTACCACATCGGAGTCGGCGACTACCCG
GCCGGCCGCATCCTCCACACGCACACGCTGCCGACGGCCCTGGACGAGGAGTCGCTCGGCGGCGAGCCCCAGCGG
CTGCGGACCAGCATCGGCCTCGGCGGCGTCGAGCTCAACTTCTACAGCAAGGTGGTTGCCGCCAACATCGAGGCA
TCCAACGGCATCATCCACGCCGTCAACCACGTGCTCGTGCCGCCCTTCATGGTCGGCCGCCTGCTCACCCTGTTC
CCGAGCCGGTTCTCGACGCTGCTGCTGGCGTACGAGAAGACGGACTTTGTCGACTTCATCCACAAGGTCAGCTTG
GTCGGCAGTACCGTCTTCGCGCCCAGCAACGACGCCTTCGGCCGGCTGGGCGCCCGGGCCAACGCCTTCCTCTTC
AACACGCAGACGGGCCACAAGTACCTGCGCGCCCTGCTCAAGTACCACGTCTCGCCTAACGCGACGCTGTACAGC
GACGCCTACTACGACAAGACGGACGGCGGCTCCGGCGCCGGCGGCCGCGGCCTGAGGCGGGAGCACTACGACCTG
CCGACGCTGCTCGGCGACGCCCGCGTGGCCGTCGACAAGGTCAAGCTGGGCCCCTTCTCCGTCGTGCGCGTCAAC
GGCTTCGCCCACGTGGCGGTGCGCGACGCCGTGGCCAAGAACGGCGTGATTCAGGTGCTGGACCAGGTGTTGGTG
CCGCCGTGTAAGCACCGGAAGCGGTCCGGGGCCGACGATAAGGCCGGCGGCGAGATGGAGGTGGAGGAGCTCAAG
GAGAGGCTGGCGGCGTACGTGTAA
Gene >Hirsu2|2561
ATGAGACTCGTCCTTACCGCCTTGGCAGCCGCCGCCCTCTCCGGGGCCATCGTCGTCCCGGACCGCCTCCCAGCC
GTGCTCAACAAGCAGCAGGTCCCGCTGTCCGGACCGTCCCCGGCGGACGGTGAGACAGCCCCGCTCCCGTCCGAC
GACGATGCCGCCCCGGCCGGCTTCCCGGCGGCCAAGGTCGAGTCCCTCGTCCGGCTCGCGGCGGACCGCGTGGCC
GAGCTCGTCGACAGCACCCTCGAGTCCGTCCAGGACGCCGTCCAGGACGCCGGCCACGACCAGCTCTCGTCCGGC
CTCTCCGATGCCCTCGCCGGCGGGCGGCACGGCGACAAGCGGCCGCACCGGACCATCTACGAGCTCATCCGCGGC
TGCAAGCACACGTCCCGCTTCGCCGCCGCGGTCGACGAGCACCCCGACATCGTGAAGCTGCTCAACAGCAGCCAC
GCCCGCCACACCCTCTTCGTTCCCACCGACGAGGCCTTCCGGCGGCTCCCCGGCCATCACGGCGACGGCGACGGC
GGCGGCGAGCACAAGGTCGGCAAGGAATTCGTCGAGCACGTCCTGCGCTACCACATCGGAGTCGGCGACTACCCG
GCCGGCCGCATCCTCCACACGCACACGCTGCCGACGGCCCTGGACGAGGAGTCGCTCGGCGGCGAGCCCCAGCGG
CTGCGGACCAGCATCGGCCTCGGCGGCGTCGAGCTCAACTTCTACAGCAAGGTGGTTGCCGCCAACATCGTGAGC
CTTGCCATCCCCCTCCTCTCCCCTAACTTGGTCGCTGGCGAGCCGCTGCTGACGGTGGCGGAACAGGAGGCATCC
AACGGCATCATCCACGCCGTCAACCACGTGCTCGTGCCGCCCTTCATGGTCGGCCGCCTGCTCACCCTGTTCCCG
AGCCGGTTCTCGACGCTGCTGCTGGCGTACGAGAAGACGGACTTTGTCGACTTCATCCACAAGGTCAGCTTGGTC
GGCAGTACCGTCTTCGCGCCCAGCAACGACGCCTTCGGCCGGCTGGGCGCCCGGGCCAACGCCTTCCTCTTCAAC
ACGCAGACGGGCCACAAGTACCTGCGCGCCCTGCTCAAGTACCACGTCTCGCCTAACGCGACGCTGTACAGCGAC
GCCTACTACGACAAGACGGACGGCGGCTCCGGCGCCGGCGGCCGCGGCCTGAGGCGGGAGCACTACGACCTGCCG
ACGCTGCTCGGCGACGCCCGCGTGGCCGTCGACAAGGTCAAGCTGGGCCCCTTCTCCGTCGTGCGCGTCAACGGC
TTCGCCCACGTGGCGGTGCGCGACGCCGTGGCCAAGAACGGCGTGATTCAGGTGCTGGACCAGGTGTTGGTGCCG
CCGTGTAAGCACCGGAAGCGGTCCGGGGCCGACGATAAGGCCGGCGGCGAGATGGAGGTGGAGGAGCTCAAGGAG
AGGCTGGCGGCGTACGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail