Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2551
Gene name
LocationContig_161:20514..21964
Strand-
Gene length (bp)1450
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16717 RAC_head Ribosome-associated complex head domain 8.9E-29 346 443
PF00226 DnaJ DnaJ domain 4.2E-20 101 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7I8|ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zuo1 PE=1 SV=2 21 442 2.0E-119
sp|P32527|ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZUO1 PE=1 SV=1 9 294 6.0E-85
sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=1 SV=1 38 420 8.0E-71
sp|Q99543|DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens GN=DNAJC2 PE=1 SV=4 31 420 4.0E-64
sp|Q1RMH9|DNJC2_BOVIN DnaJ homolog subfamily C member 2 OS=Bos taurus GN=DNAJC2 PE=2 SV=1 31 411 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7I8|ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zuo1 PE=1 SV=2 21 442 2.0E-119
sp|P32527|ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZUO1 PE=1 SV=1 9 294 6.0E-85
sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=1 SV=1 38 420 8.0E-71
sp|Q99543|DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens GN=DNAJC2 PE=1 SV=4 31 420 4.0E-64
sp|Q1RMH9|DNJC2_BOVIN DnaJ homolog subfamily C member 2 OS=Bos taurus GN=DNAJC2 PE=2 SV=1 31 411 4.0E-64
sp|Q4R8H2|DNJC2_MACFA DnaJ homolog subfamily C member 2 OS=Macaca fascicularis GN=DNAJC2 PE=2 SV=1 31 420 3.0E-63
sp|Q6NWJ4|DNJC2_DANRE DnaJ homolog subfamily C member 2 OS=Danio rerio GN=dnajc2 PE=2 SV=1 30 395 3.0E-63
sp|P54103|DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus GN=Dnajc2 PE=1 SV=2 31 415 6.0E-63
sp|Q6P2Y3|DNJC2_XENTR DnaJ homolog subfamily C member 2 OS=Xenopus tropicalis GN=dnajc2 PE=2 SV=2 24 412 2.0E-62
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 102 315 1.0E-14
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 102 305 3.0E-14
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 102 305 4.0E-14
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 77 178 5.0E-12
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 100 168 2.0E-09
sp|P40170|DNAJ1_STRCO Chaperone protein DnaJ 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ1 PE=3 SV=2 92 168 4.0E-09
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 98 191 5.0E-09
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 98 173 8.0E-09
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 99 168 8.0E-09
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 98 177 8.0E-09
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 100 168 1.0E-08
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 98 173 1.0E-08
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 98 173 2.0E-08
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 99 168 2.0E-08
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 100 199 2.0E-08
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 100 168 3.0E-08
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 100 168 3.0E-08
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 99 174 3.0E-08
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 101 168 3.0E-08
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 100 190 4.0E-08
sp|Q95KD5|DJC18_MACFA DnaJ homolog subfamily C member 18 OS=Macaca fascicularis GN=DNAJC18 PE=2 SV=1 98 179 4.0E-08
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 100 190 4.0E-08
sp|Q9H819|DJC18_HUMAN DnaJ homolog subfamily C member 18 OS=Homo sapiens GN=DNAJC18 PE=2 SV=1 98 179 5.0E-08
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 91 189 6.0E-08
sp|Q5EA26|DJC18_BOVIN DnaJ homolog subfamily C member 18 OS=Bos taurus GN=DNAJC18 PE=2 SV=1 98 179 6.0E-08
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 91 189 6.0E-08
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 100 178 6.0E-08
sp|B9LUC6|DNAJ_HALLT Chaperone protein DnaJ OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaJ PE=3 SV=1 99 170 7.0E-08
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 99 174 7.0E-08
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 100 168 7.0E-08
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 98 173 7.0E-08
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 92 168 8.0E-08
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 91 178 8.0E-08
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 100 168 8.0E-08
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 98 173 8.0E-08
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 98 173 9.0E-08
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 100 168 9.0E-08
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 100 178 1.0E-07
sp|Q82EX7|DNAJ1_STRAW Chaperone protein DnaJ 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ1 PE=3 SV=1 92 168 1.0E-07
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 100 174 1.0E-07
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 100 174 1.0E-07
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 98 174 2.0E-07
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 100 174 2.0E-07
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 100 168 2.0E-07
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 100 174 2.0E-07
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 100 174 2.0E-07
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 98 173 3.0E-07
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 100 178 3.0E-07
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 101 176 3.0E-07
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 100 168 3.0E-07
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 100 174 4.0E-07
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 99 168 4.0E-07
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 100 174 4.0E-07
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 100 174 4.0E-07
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 101 197 4.0E-07
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 101 174 4.0E-07
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 100 168 4.0E-07
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 101 168 4.0E-07
sp|Q9PQ82|DNAJ_UREPA Chaperone protein DnaJ OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaJ PE=3 SV=1 100 168 4.0E-07
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 101 174 5.0E-07
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 100 168 5.0E-07
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 101 197 5.0E-07
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 100 174 5.0E-07
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 100 174 5.0E-07
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 100 174 5.0E-07
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 100 178 5.0E-07
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 101 174 5.0E-07
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 100 174 5.0E-07
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 100 174 6.0E-07
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 101 168 7.0E-07
sp|Q9VGR7|Y6693_DROME J domain-containing protein CG6693 OS=Drosophila melanogaster GN=CG6693 PE=1 SV=1 90 198 7.0E-07
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 101 168 7.0E-07
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 100 178 7.0E-07
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 100 168 7.0E-07
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 101 174 7.0E-07
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 100 174 7.0E-07
sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 100 174 7.0E-07
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 99 174 7.0E-07
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 99 174 7.0E-07
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 100 173 8.0E-07
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 100 168 8.0E-07
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 100 168 8.0E-07
sp|Q5YNI2|DNAJ2_NOCFA Chaperone protein DnaJ 2 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ2 PE=3 SV=1 92 168 8.0E-07
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 100 168 1.0E-06
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 100 178 1.0E-06
sp|Q8VXV4|DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1 100 174 1.0E-06
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 100 168 1.0E-06
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 98 227 1.0E-06
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 100 178 1.0E-06
sp|Q98PI9|DNAJ_MYCPU Chaperone protein DnaJ OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaJ PE=3 SV=2 98 178 1.0E-06
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 100 168 1.0E-06
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 100 178 2.0E-06
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 98 227 2.0E-06
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 100 178 2.0E-06
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 100 173 2.0E-06
sp|Q80Y75|DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus GN=Dnajb13 PE=1 SV=1 101 174 2.0E-06
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 98 168 2.0E-06
sp|Q3IUB7|DNAJ_NATPD Chaperone protein DnaJ OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaJ PE=3 SV=1 99 173 2.0E-06
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 100 174 2.0E-06
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 101 174 2.0E-06
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 100 174 2.0E-06
sp|Q601X8|DNAJ_MYCH2 Chaperone protein DnaJ OS=Mycoplasma hyopneumoniae (strain 232) GN=dnaJ PE=3 SV=2 100 168 2.0E-06
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 100 168 3.0E-06
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 101 168 3.0E-06
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 100 174 3.0E-06
sp|Q9HHB8|DNAJ_HALMT Chaperone protein DnaJ OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaJ PE=3 SV=1 99 173 3.0E-06
sp|P25294|SIS1_YEAST Protein SIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS1 PE=1 SV=1 103 174 3.0E-06
sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 103 168 3.0E-06
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 100 174 3.0E-06
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 100 168 3.0E-06
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 100 178 4.0E-06
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 100 197 4.0E-06
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 100 178 4.0E-06
sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 102 168 4.0E-06
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 101 168 4.0E-06
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 101 168 4.0E-06
sp|Q6A662|DNAJ2_PROAC Chaperone protein DnaJ 2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ2 PE=3 SV=1 92 168 4.0E-06
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 100 168 4.0E-06
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 101 168 4.0E-06
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 100 178 4.0E-06
sp|Q9ZSY2|DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1 100 174 5.0E-06
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 102 180 5.0E-06
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 100 168 5.0E-06
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 100 178 6.0E-06
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 100 174 6.0E-06
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 102 168 6.0E-06
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 102 168 6.0E-06
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 100 178 6.0E-06
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 98 174 7.0E-06
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 98 174 7.0E-06
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 100 168 7.0E-06
sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 98 170 7.0E-06
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 101 174 7.0E-06
sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 101 168 7.0E-06
sp|Q8FM80|DNAJ2_COREF Chaperone protein DnaJ 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dnaJ2 PE=3 SV=1 92 170 8.0E-06
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 102 174 8.0E-06
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 100 168 9.0E-06
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 98 174 9.0E-06
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 98 174 9.0E-06
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 100 178 9.0E-06
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 98 174 9.0E-06
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 98 174 1.0E-05
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 100 169 1.0E-05
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 100 168 1.0E-05
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 100 197 1.0E-05
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 100 168 1.0E-05
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.6164 0.5457 0.0091 0.0889 0.185 0.0038 0.2035 0.0905 0.0466 0.0054

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2131
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3681
Ophiocordyceps australis map64 (Brazil) OphauB2|3981
Ophiocordyceps camponoti-floridani Ophcf2|02956
Ophiocordyceps camponoti-rufipedis Ophun1|6298
Ophiocordyceps kimflemingae Ophio5|6918
Ophiocordyceps subramaniannii Hirsu2|2551 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2551
MATAAQMTITLPVLPGGWSAEKDFKAVGRLSGATQRSIEPVGPHFLAHARRSRNNRTFSEDDRIQAQENAKKIED
GDESEASEAEDPMMLQLQAKDWKTQDHYKVLGLSKHRYKATEEQIKKAHRKKVLKHHPDKKAAQGRTEDDQFFKC
IQKATEVLLDPVKRRQYDSVDEEADVEPPTKKQLQKGDFYKLWSKVFKSEARFSRAHPVPTFGDTHSTREHVEDF
YNFWYNFDSWRSFEYLDEDVPDDNENRDQKRHVERKNANARKKKKAEDNARLRKLLDDCSAGDERIKRFRQEANA
AKNRKRLEKEAAERQAADEARAKKEADAAAAREAEERAKTDREAAKKAKEAAKNAVKKNKRVLKGSVKDANYFAP
AGADASPAQIDAVLGDVELIQAKMEPDEIAALAASLGGLSLAADIKAAWGAELARLVAAGKLKQGDAKTLQS*
Coding >Hirsu2|2551
ATGGCGACGGCGGCGCAGATGACCATCACGCTGCCCGTGCTCCCCGGCGGATGGAGCGCCGAGAAGGACTTCAAG
GCCGTCGGCCGTCTCTCGGGCGCTACCCAGCGAAGCATCGAGCCGGTCGGGCCTCACTTCCTCGCTCACGCTCGA
CGATCTCGGAACAATCGCACTTTCTCCGAAGATGACCGCATCCAGGCCCAGGAGAATGCCAAGAAGATCGAGGAC
GGCGACGAGAGCGAAGCAAGCGAGGCCGAGGATCCCATGATGCTCCAGCTGCAGGCCAAGGACTGGAAGACCCAA
GACCACTACAAGGTGCTCGGCCTGTCCAAGCACCGCTACAAGGCGACTGAGGAGCAGATCAAGAAGGCGCATCGC
AAGAAGGTGCTGAAGCATCACCCGGACAAGAAGGCGGCGCAGGGCCGGACCGAGGACGACCAGTTCTTCAAGTGC
ATCCAGAAGGCGACCGAGGTGTTGCTGGACCCGGTCAAGCGGAGGCAGTACGACTCGGTGGACGAGGAGGCCGAC
GTCGAGCCGCCGACCAAGAAGCAGCTGCAGAAGGGCGACTTCTATAAGCTGTGGAGCAAGGTCTTCAAGTCCGAG
GCCCGCTTCTCCCGGGCGCACCCGGTGCCGACATTCGGCGACACGCACTCGACGCGGGAGCACGTCGAGGACTTC
TACAACTTCTGGTACAACTTCGACAGCTGGCGCTCCTTCGAGTACCTAGACGAGGACGTGCCGGACGACAACGAG
AACCGCGACCAGAAGCGACACGTGGAGCGCAAGAACGCCAACGCGCGCAAGAAGAAGAAGGCCGAGGACAACGCG
CGCCTGCGCAAGCTGCTGGACGACTGCTCGGCGGGCGACGAGCGCATCAAGCGCTTCCGGCAGGAGGCCAACGCG
GCCAAGAACCGCAAGCGGCTCGAGAAGGAGGCGGCCGAGCGGCAGGCGGCCGACGAGGCCCGGGCCAAGAAGGAG
GCGGACGCGGCGGCGGCGCGCGAGGCCGAGGAGCGCGCCAAGACGGACCGCGAGGCGGCCAAGAAGGCCAAGGAG
GCGGCCAAGAACGCCGTCAAGAAGAACAAGCGCGTGCTCAAGGGCTCCGTCAAGGACGCCAACTACTTCGCCCCC
GCCGGCGCCGACGCCTCGCCCGCCCAGATCGACGCCGTCCTCGGCGACGTCGAGCTCATCCAGGCCAAGATGGAG
CCGGACGAGATCGCGGCCCTGGCCGCCAGCCTCGGCGGCCTGAGCCTCGCCGCCGACATCAAGGCCGCCTGGGGC
GCCGAGCTCGCCCGCCTCGTCGCCGCCGGCAAGCTCAAGCAGGGCGACGCCAAGACGCTGCAGTCGTGA
Transcript >Hirsu2|2551
ATGGCGACGGCGGCGCAGATGACCATCACGCTGCCCGTGCTCCCCGGCGGATGGAGCGCCGAGAAGGACTTCAAG
GCCGTCGGCCGTCTCTCGGGCGCTACCCAGCGAAGCATCGAGCCGGTCGGGCCTCACTTCCTCGCTCACGCTCGA
CGATCTCGGAACAATCGCACTTTCTCCGAAGATGACCGCATCCAGGCCCAGGAGAATGCCAAGAAGATCGAGGAC
GGCGACGAGAGCGAAGCAAGCGAGGCCGAGGATCCCATGATGCTCCAGCTGCAGGCCAAGGACTGGAAGACCCAA
GACCACTACAAGGTGCTCGGCCTGTCCAAGCACCGCTACAAGGCGACTGAGGAGCAGATCAAGAAGGCGCATCGC
AAGAAGGTGCTGAAGCATCACCCGGACAAGAAGGCGGCGCAGGGCCGGACCGAGGACGACCAGTTCTTCAAGTGC
ATCCAGAAGGCGACCGAGGTGTTGCTGGACCCGGTCAAGCGGAGGCAGTACGACTCGGTGGACGAGGAGGCCGAC
GTCGAGCCGCCGACCAAGAAGCAGCTGCAGAAGGGCGACTTCTATAAGCTGTGGAGCAAGGTCTTCAAGTCCGAG
GCCCGCTTCTCCCGGGCGCACCCGGTGCCGACATTCGGCGACACGCACTCGACGCGGGAGCACGTCGAGGACTTC
TACAACTTCTGGTACAACTTCGACAGCTGGCGCTCCTTCGAGTACCTAGACGAGGACGTGCCGGACGACAACGAG
AACCGCGACCAGAAGCGACACGTGGAGCGCAAGAACGCCAACGCGCGCAAGAAGAAGAAGGCCGAGGACAACGCG
CGCCTGCGCAAGCTGCTGGACGACTGCTCGGCGGGCGACGAGCGCATCAAGCGCTTCCGGCAGGAGGCCAACGCG
GCCAAGAACCGCAAGCGGCTCGAGAAGGAGGCGGCCGAGCGGCAGGCGGCCGACGAGGCCCGGGCCAAGAAGGAG
GCGGACGCGGCGGCGGCGCGCGAGGCCGAGGAGCGCGCCAAGACGGACCGCGAGGCGGCCAAGAAGGCCAAGGAG
GCGGCCAAGAACGCCGTCAAGAAGAACAAGCGCGTGCTCAAGGGCTCCGTCAAGGACGCCAACTACTTCGCCCCC
GCCGGCGCCGACGCCTCGCCCGCCCAGATCGACGCCGTCCTCGGCGACGTCGAGCTCATCCAGGCCAAGATGGAG
CCGGACGAGATCGCGGCCCTGGCCGCCAGCCTCGGCGGCCTGAGCCTCGCCGCCGACATCAAGGCCGCCTGGGGC
GCCGAGCTCGCCCGCCTCGTCGCCGCCGGCAAGCTCAAGCAGGGCGACGCCAAGACGCTGCAGTCGTGA
Gene >Hirsu2|2551
ATGGCGACGGCGGCGCAGATGACCATCACGCTGCCCGTGCTCCCCGGCGGATGGAGCGCCGAGAAGGACTTCAAG
GCCGTCGGCCGTCTCTCGGGCGCTACCCAGCGAAGCATCGAGCCGGTCGGGCCTCACTTCCTCGCTCACGCTCGA
CGATCTCGGAACAATCGCACTTTCTCCGAAGATGACCGCATCCAGGCCCAGGAGAATGCCAAGAAGATCGAGGAC
GGCGACGAGAGCGAAGCAAGCGAGGCCGAGGATCCCATGATGCTCCAGCTGCAGGCCAAGGACTGGAAGGTTGGC
TTCCCCCCCTCGCCCCCTGCTGGAAATCATCCAGTCTCGCGGCCGTCGCGGCCGTGACGCAGGAGTCGGCGCTGA
CTTGACACGTGTCTCCCTTTGCCAGACCCAAGACCACTACAAGGTGCTCGGCCTGTCCAAGCACCGCTACAAGGC
GACTGAGGAGCAGATCAAGAAGGCGCATCGCAAGAAGGTGCTGAAGCATCACCCGGACAAGAAGGCGGCGCAGGG
CCGGACCGAGGACGACCAGTTCTTCAAGTGCATCCAGAAGGCGACCGAGGTGTTGCTGGACCCGGTCAAGCGGAG
GCAGTACGACTCGGTGGACGAGGAGGCCGACGTCGAGCCGCCGACCAAGAAGCAGCTGCAGAAGGGCGACTTCTA
TAAGCTGTGGAGCAAGGTCTTCAAGTCCGAGGCCCGCTTCTCCCGGGCGCACCCGGTGCCGACATTCGGCGACAC
GCACTCGACGCGGGAGCACGTCGAGGACTTCTACAACTTCTGGTACAACTTCGACAGCTGGCGCTCCTTCGAGTA
CCTAGACGAGGACGTGCCGGACGACAACGAGAACCGCGACCAGAAGCGACACGTGGAGCGCAAGAACGCCAACGC
GCGCAAGAAGAAGAAGGCCGAGGACAACGCGCGCCTGCGCAAGCTGCTGGACGACTGCTCGGCGGGCGACGAGCG
CATCAAGCGCTTCCGGCAGGAGGCCAACGCGGCCAAGAACCGCAAGCGGCTCGAGAAGGAGGCGGCCGAGCGGCA
GGCGGCCGACGAGGCCCGGGCCAAGAAGGAGGCGGACGCGGCGGCGGCGCGCGAGGCCGAGGAGCGCGCCAAGAC
GGACCGCGAGGCGGCCAAGAAGGCCAAGGAGGCGGCCAAGAACGCCGTCAAGAAGAACAAGCGCGTGCTCAAGGG
CTCCGTCAAGGACGCCAACTACTTCGCCCCCGCCGGCGCCGACGCCTCGCCCGCCCAGATCGACGCCGTCCTCGG
CGACGTCGAGCTCATCCAGGCCAAGATGGAGCCGGACGAGATCGCGGCCCTGGCCGCCAGCCTCGGCGGCCTGAG
CCTCGCCGCCGACATCAAGGCCGCCTGGGGCGCCGAGCTCGCCCGCCTCGTCGCCGCCGGCAAGCTCAAGCAGGG
CGACGCCAAGACGCTGCAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail