Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2551
Gene name
LocationContig_161:20514..21964
Strand-
Gene length (bp)1450
Transcript length (bp)1344
Coding sequence length (bp)1344
Protein length (aa) 448

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16717 RAC_head Ribosome-associated complex head domain 4.7E-28 346 443
PF00226 DnaJ DnaJ domain 4.2E-20 101 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7I8|ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zuo1 PE=1 SV=2 21 442 2.0E-119
sp|P32527|ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZUO1 PE=1 SV=1 9 294 6.0E-85
sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=1 SV=1 38 420 8.0E-71
sp|Q99543|DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens GN=DNAJC2 PE=1 SV=4 31 420 4.0E-64
sp|Q1RMH9|DNJC2_BOVIN DnaJ homolog subfamily C member 2 OS=Bos taurus GN=DNAJC2 PE=2 SV=1 31 411 4.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7I8|ZUO1_SCHPO Zuotin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zuo1 PE=1 SV=2 21 442 2.0E-119
sp|P32527|ZUO1_YEAST Zuotin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZUO1 PE=1 SV=1 9 294 6.0E-85
sp|Q7TQ20|DNJC2_RAT DnaJ homolog subfamily C member 2 OS=Rattus norvegicus GN=Dnajc2 PE=1 SV=1 38 420 8.0E-71
sp|Q99543|DNJC2_HUMAN DnaJ homolog subfamily C member 2 OS=Homo sapiens GN=DNAJC2 PE=1 SV=4 31 420 4.0E-64
sp|Q1RMH9|DNJC2_BOVIN DnaJ homolog subfamily C member 2 OS=Bos taurus GN=DNAJC2 PE=2 SV=1 31 411 4.0E-64
sp|Q4R8H2|DNJC2_MACFA DnaJ homolog subfamily C member 2 OS=Macaca fascicularis GN=DNAJC2 PE=2 SV=1 31 420 3.0E-63
sp|Q6NWJ4|DNJC2_DANRE DnaJ homolog subfamily C member 2 OS=Danio rerio GN=dnajc2 PE=2 SV=1 30 395 3.0E-63
sp|P54103|DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus GN=Dnajc2 PE=1 SV=2 31 415 6.0E-63
sp|Q6P2Y3|DNJC2_XENTR DnaJ homolog subfamily C member 2 OS=Xenopus tropicalis GN=dnajc2 PE=2 SV=2 24 412 2.0E-62
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 102 315 1.0E-14
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 102 305 3.0E-14
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 102 305 4.0E-14
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 77 178 5.0E-12
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 100 168 2.0E-09
sp|P40170|DNAJ1_STRCO Chaperone protein DnaJ 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ1 PE=3 SV=2 92 168 4.0E-09
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 98 191 5.0E-09
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 98 173 8.0E-09
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 99 168 8.0E-09
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 98 177 8.0E-09
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 100 168 1.0E-08
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 98 173 1.0E-08
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 98 173 2.0E-08
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 99 168 2.0E-08
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 100 199 2.0E-08
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 100 168 3.0E-08
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 100 168 3.0E-08
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 99 174 3.0E-08
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 101 168 3.0E-08
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 100 190 4.0E-08
sp|Q95KD5|DJC18_MACFA DnaJ homolog subfamily C member 18 OS=Macaca fascicularis GN=DNAJC18 PE=2 SV=1 98 179 4.0E-08
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 100 190 4.0E-08
sp|Q9H819|DJC18_HUMAN DnaJ homolog subfamily C member 18 OS=Homo sapiens GN=DNAJC18 PE=2 SV=1 98 179 5.0E-08
sp|Q9QYI3|DNJC7_MOUSE DnaJ homolog subfamily C member 7 OS=Mus musculus GN=Dnajc7 PE=1 SV=2 91 189 6.0E-08
sp|Q5EA26|DJC18_BOVIN DnaJ homolog subfamily C member 18 OS=Bos taurus GN=DNAJC18 PE=2 SV=1 98 179 6.0E-08
sp|Q99615|DNJC7_HUMAN DnaJ homolog subfamily C member 7 OS=Homo sapiens GN=DNAJC7 PE=1 SV=2 91 189 6.0E-08
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 100 178 6.0E-08
sp|B9LUC6|DNAJ_HALLT Chaperone protein DnaJ OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=dnaJ PE=3 SV=1 99 170 7.0E-08
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 99 174 7.0E-08
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 100 168 7.0E-08
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 98 173 7.0E-08
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 92 168 8.0E-08
sp|Q5R8D8|DNJC7_PONAB DnaJ homolog subfamily C member 7 OS=Pongo abelii GN=DNAJC7 PE=2 SV=1 91 178 8.0E-08
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 100 168 8.0E-08
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 98 173 8.0E-08
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 98 173 9.0E-08
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 100 168 9.0E-08
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 100 178 1.0E-07
sp|Q82EX7|DNAJ1_STRAW Chaperone protein DnaJ 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ1 PE=3 SV=1 92 168 1.0E-07
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 100 174 1.0E-07
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 100 174 1.0E-07
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 98 174 2.0E-07
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 100 174 2.0E-07
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 100 168 2.0E-07
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 100 174 2.0E-07
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 100 174 2.0E-07
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 98 173 3.0E-07
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 100 178 3.0E-07
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 101 176 3.0E-07
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 100 168 3.0E-07
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 100 174 4.0E-07
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 99 168 4.0E-07
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 100 174 4.0E-07
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 100 174 4.0E-07
sp|Q54IP0|DNJC7_DICDI DnaJ homolog subfamily C member 7 homolog OS=Dictyostelium discoideum GN=dnajc7 PE=1 SV=1 101 197 4.0E-07
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 101 174 4.0E-07
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 100 168 4.0E-07
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 101 168 4.0E-07
sp|Q9PQ82|DNAJ_UREPA Chaperone protein DnaJ OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dnaJ PE=3 SV=1 100 168 4.0E-07
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 101 174 5.0E-07
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 100 168 5.0E-07
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 101 197 5.0E-07
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 100 174 5.0E-07
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 100 174 5.0E-07
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 100 174 5.0E-07
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 100 178 5.0E-07
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 101 174 5.0E-07
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 100 174 5.0E-07
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 100 174 6.0E-07
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 101 168 7.0E-07
sp|Q9VGR7|Y6693_DROME J domain-containing protein CG6693 OS=Drosophila melanogaster GN=CG6693 PE=1 SV=1 90 198 7.0E-07
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 101 168 7.0E-07
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 100 178 7.0E-07
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 100 168 7.0E-07
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 101 174 7.0E-07
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 100 174 7.0E-07
sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 100 174 7.0E-07
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 99 174 7.0E-07
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 99 174 7.0E-07
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 100 173 8.0E-07
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 100 168 8.0E-07
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 100 168 8.0E-07
sp|Q5YNI2|DNAJ2_NOCFA Chaperone protein DnaJ 2 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ2 PE=3 SV=1 92 168 8.0E-07
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 100 168 9.0E-07
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 100 168 1.0E-06
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 100 178 1.0E-06
sp|Q8VXV4|DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1 100 174 1.0E-06
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 100 168 1.0E-06
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 98 227 1.0E-06
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 100 178 1.0E-06
sp|Q98PI9|DNAJ_MYCPU Chaperone protein DnaJ OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaJ PE=3 SV=2 98 178 1.0E-06
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 100 168 1.0E-06
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 100 178 2.0E-06
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 98 227 2.0E-06
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 100 178 2.0E-06
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 100 168 2.0E-06
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 100 173 2.0E-06
sp|Q80Y75|DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus GN=Dnajb13 PE=1 SV=1 101 174 2.0E-06
sp|Q54M21|DNJC3_DICDI DnaJ homolog subfamily C member 3 homolog OS=Dictyostelium discoideum GN=dnajc3 PE=3 SV=1 98 168 2.0E-06
sp|Q3IUB7|DNAJ_NATPD Chaperone protein DnaJ OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=dnaJ PE=3 SV=1 99 173 2.0E-06
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 100 174 2.0E-06
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 101 174 2.0E-06
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 100 174 2.0E-06
sp|Q601X8|DNAJ_MYCH2 Chaperone protein DnaJ OS=Mycoplasma hyopneumoniae (strain 232) GN=dnaJ PE=3 SV=2 100 168 2.0E-06
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 100 168 3.0E-06
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 101 168 3.0E-06
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 100 174 3.0E-06
sp|Q9HHB8|DNAJ_HALMT Chaperone protein DnaJ OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaJ PE=3 SV=1 99 173 3.0E-06
sp|P25294|SIS1_YEAST Protein SIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS1 PE=1 SV=1 103 174 3.0E-06
sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 103 168 3.0E-06
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 100 174 3.0E-06
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 100 168 3.0E-06
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 100 178 4.0E-06
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 100 197 4.0E-06
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 100 178 4.0E-06
sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 102 168 4.0E-06
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 101 168 4.0E-06
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 101 168 4.0E-06
sp|Q6A662|DNAJ2_PROAC Chaperone protein DnaJ 2 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ2 PE=3 SV=1 92 168 4.0E-06
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 100 168 4.0E-06
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 101 168 4.0E-06
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 100 178 4.0E-06
sp|Q9ZSY2|DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1 100 174 5.0E-06
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 102 180 5.0E-06
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 100 168 5.0E-06
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 100 178 6.0E-06
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 100 174 6.0E-06
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|Q3B2T5|DNAJ_CHLL7 Chaperone protein DnaJ OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaJ PE=3 SV=1 100 168 6.0E-06
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 102 168 6.0E-06
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 102 168 6.0E-06
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 100 178 6.0E-06
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 100 169 6.0E-06
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 98 174 7.0E-06
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 98 174 7.0E-06
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 100 168 7.0E-06
sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 98 170 7.0E-06
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 101 174 7.0E-06
sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 101 168 7.0E-06
sp|Q8FM80|DNAJ2_COREF Chaperone protein DnaJ 2 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dnaJ2 PE=3 SV=1 92 170 8.0E-06
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 102 174 8.0E-06
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 100 168 9.0E-06
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 98 174 9.0E-06
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 98 174 9.0E-06
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 100 178 9.0E-06
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 98 174 9.0E-06
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 98 174 1.0E-05
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 100 169 1.0E-05
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 100 168 1.0E-05
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 100 197 1.0E-05
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 100 168 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2551
MATAAQMTITLPVLPGGWSAEKDFKAVGRLSGATQRSIEPVGPHFLAHARRSRNNRTFSEDDRIQAQENAKKIED
GDESEASEAEDPMMLQLQAKDWKTQDHYKVLGLSKHRYKATEEQIKKAHRKKVLKHHPDKKAAQGRTEDDQFFKC
IQKATEVLLDPVKRRQYDSVDEEADVEPPTKKQLQKGDFYKLWSKVFKSEARFSRAHPVPTFGDTHSTREHVEDF
YNFWYNFDSWRSFEYLDEDVPDDNENRDQKRHVERKNANARKKKKAEDNARLRKLLDDCSAGDERIKRFRQEANA
AKNRKRLEKEAAERQAADEARAKKEADAAAAREAEERAKTDREAAKKAKEAAKNAVKKNKRVLKGSVKDANYFAP
AGADASPAQIDAVLGDVELIQAKMEPDEIAALAASLGGLSLAADIKAAWGAELARLVAAGKLKQGDAKTLQS*
Coding >Hirsu2|2551
ATGGCGACGGCGGCGCAGATGACCATCACGCTGCCCGTGCTCCCCGGCGGATGGAGCGCCGAGAAGGACTTCAAG
GCCGTCGGCCGTCTCTCGGGCGCTACCCAGCGAAGCATCGAGCCGGTCGGGCCTCACTTCCTCGCTCACGCTCGA
CGATCTCGGAACAATCGCACTTTCTCCGAAGATGACCGCATCCAGGCCCAGGAGAATGCCAAGAAGATCGAGGAC
GGCGACGAGAGCGAAGCAAGCGAGGCCGAGGATCCCATGATGCTCCAGCTGCAGGCCAAGGACTGGAAGACCCAA
GACCACTACAAGGTGCTCGGCCTGTCCAAGCACCGCTACAAGGCGACTGAGGAGCAGATCAAGAAGGCGCATCGC
AAGAAGGTGCTGAAGCATCACCCGGACAAGAAGGCGGCGCAGGGCCGGACCGAGGACGACCAGTTCTTCAAGTGC
ATCCAGAAGGCGACCGAGGTGTTGCTGGACCCGGTCAAGCGGAGGCAGTACGACTCGGTGGACGAGGAGGCCGAC
GTCGAGCCGCCGACCAAGAAGCAGCTGCAGAAGGGCGACTTCTATAAGCTGTGGAGCAAGGTCTTCAAGTCCGAG
GCCCGCTTCTCCCGGGCGCACCCGGTGCCGACATTCGGCGACACGCACTCGACGCGGGAGCACGTCGAGGACTTC
TACAACTTCTGGTACAACTTCGACAGCTGGCGCTCCTTCGAGTACCTAGACGAGGACGTGCCGGACGACAACGAG
AACCGCGACCAGAAGCGACACGTGGAGCGCAAGAACGCCAACGCGCGCAAGAAGAAGAAGGCCGAGGACAACGCG
CGCCTGCGCAAGCTGCTGGACGACTGCTCGGCGGGCGACGAGCGCATCAAGCGCTTCCGGCAGGAGGCCAACGCG
GCCAAGAACCGCAAGCGGCTCGAGAAGGAGGCGGCCGAGCGGCAGGCGGCCGACGAGGCCCGGGCCAAGAAGGAG
GCGGACGCGGCGGCGGCGCGCGAGGCCGAGGAGCGCGCCAAGACGGACCGCGAGGCGGCCAAGAAGGCCAAGGAG
GCGGCCAAGAACGCCGTCAAGAAGAACAAGCGCGTGCTCAAGGGCTCCGTCAAGGACGCCAACTACTTCGCCCCC
GCCGGCGCCGACGCCTCGCCCGCCCAGATCGACGCCGTCCTCGGCGACGTCGAGCTCATCCAGGCCAAGATGGAG
CCGGACGAGATCGCGGCCCTGGCCGCCAGCCTCGGCGGCCTGAGCCTCGCCGCCGACATCAAGGCCGCCTGGGGC
GCCGAGCTCGCCCGCCTCGTCGCCGCCGGCAAGCTCAAGCAGGGCGACGCCAAGACGCTGCAGTCGTGA
Transcript >Hirsu2|2551
ATGGCGACGGCGGCGCAGATGACCATCACGCTGCCCGTGCTCCCCGGCGGATGGAGCGCCGAGAAGGACTTCAAG
GCCGTCGGCCGTCTCTCGGGCGCTACCCAGCGAAGCATCGAGCCGGTCGGGCCTCACTTCCTCGCTCACGCTCGA
CGATCTCGGAACAATCGCACTTTCTCCGAAGATGACCGCATCCAGGCCCAGGAGAATGCCAAGAAGATCGAGGAC
GGCGACGAGAGCGAAGCAAGCGAGGCCGAGGATCCCATGATGCTCCAGCTGCAGGCCAAGGACTGGAAGACCCAA
GACCACTACAAGGTGCTCGGCCTGTCCAAGCACCGCTACAAGGCGACTGAGGAGCAGATCAAGAAGGCGCATCGC
AAGAAGGTGCTGAAGCATCACCCGGACAAGAAGGCGGCGCAGGGCCGGACCGAGGACGACCAGTTCTTCAAGTGC
ATCCAGAAGGCGACCGAGGTGTTGCTGGACCCGGTCAAGCGGAGGCAGTACGACTCGGTGGACGAGGAGGCCGAC
GTCGAGCCGCCGACCAAGAAGCAGCTGCAGAAGGGCGACTTCTATAAGCTGTGGAGCAAGGTCTTCAAGTCCGAG
GCCCGCTTCTCCCGGGCGCACCCGGTGCCGACATTCGGCGACACGCACTCGACGCGGGAGCACGTCGAGGACTTC
TACAACTTCTGGTACAACTTCGACAGCTGGCGCTCCTTCGAGTACCTAGACGAGGACGTGCCGGACGACAACGAG
AACCGCGACCAGAAGCGACACGTGGAGCGCAAGAACGCCAACGCGCGCAAGAAGAAGAAGGCCGAGGACAACGCG
CGCCTGCGCAAGCTGCTGGACGACTGCTCGGCGGGCGACGAGCGCATCAAGCGCTTCCGGCAGGAGGCCAACGCG
GCCAAGAACCGCAAGCGGCTCGAGAAGGAGGCGGCCGAGCGGCAGGCGGCCGACGAGGCCCGGGCCAAGAAGGAG
GCGGACGCGGCGGCGGCGCGCGAGGCCGAGGAGCGCGCCAAGACGGACCGCGAGGCGGCCAAGAAGGCCAAGGAG
GCGGCCAAGAACGCCGTCAAGAAGAACAAGCGCGTGCTCAAGGGCTCCGTCAAGGACGCCAACTACTTCGCCCCC
GCCGGCGCCGACGCCTCGCCCGCCCAGATCGACGCCGTCCTCGGCGACGTCGAGCTCATCCAGGCCAAGATGGAG
CCGGACGAGATCGCGGCCCTGGCCGCCAGCCTCGGCGGCCTGAGCCTCGCCGCCGACATCAAGGCCGCCTGGGGC
GCCGAGCTCGCCCGCCTCGTCGCCGCCGGCAAGCTCAAGCAGGGCGACGCCAAGACGCTGCAGTCGTGA
Gene >Hirsu2|2551
ATGGCGACGGCGGCGCAGATGACCATCACGCTGCCCGTGCTCCCCGGCGGATGGAGCGCCGAGAAGGACTTCAAG
GCCGTCGGCCGTCTCTCGGGCGCTACCCAGCGAAGCATCGAGCCGGTCGGGCCTCACTTCCTCGCTCACGCTCGA
CGATCTCGGAACAATCGCACTTTCTCCGAAGATGACCGCATCCAGGCCCAGGAGAATGCCAAGAAGATCGAGGAC
GGCGACGAGAGCGAAGCAAGCGAGGCCGAGGATCCCATGATGCTCCAGCTGCAGGCCAAGGACTGGAAGGTTGGC
TTCCCCCCCTCGCCCCCTGCTGGAAATCATCCAGTCTCGCGGCCGTCGCGGCCGTGACGCAGGAGTCGGCGCTGA
CTTGACACGTGTCTCCCTTTGCCAGACCCAAGACCACTACAAGGTGCTCGGCCTGTCCAAGCACCGCTACAAGGC
GACTGAGGAGCAGATCAAGAAGGCGCATCGCAAGAAGGTGCTGAAGCATCACCCGGACAAGAAGGCGGCGCAGGG
CCGGACCGAGGACGACCAGTTCTTCAAGTGCATCCAGAAGGCGACCGAGGTGTTGCTGGACCCGGTCAAGCGGAG
GCAGTACGACTCGGTGGACGAGGAGGCCGACGTCGAGCCGCCGACCAAGAAGCAGCTGCAGAAGGGCGACTTCTA
TAAGCTGTGGAGCAAGGTCTTCAAGTCCGAGGCCCGCTTCTCCCGGGCGCACCCGGTGCCGACATTCGGCGACAC
GCACTCGACGCGGGAGCACGTCGAGGACTTCTACAACTTCTGGTACAACTTCGACAGCTGGCGCTCCTTCGAGTA
CCTAGACGAGGACGTGCCGGACGACAACGAGAACCGCGACCAGAAGCGACACGTGGAGCGCAAGAACGCCAACGC
GCGCAAGAAGAAGAAGGCCGAGGACAACGCGCGCCTGCGCAAGCTGCTGGACGACTGCTCGGCGGGCGACGAGCG
CATCAAGCGCTTCCGGCAGGAGGCCAACGCGGCCAAGAACCGCAAGCGGCTCGAGAAGGAGGCGGCCGAGCGGCA
GGCGGCCGACGAGGCCCGGGCCAAGAAGGAGGCGGACGCGGCGGCGGCGCGCGAGGCCGAGGAGCGCGCCAAGAC
GGACCGCGAGGCGGCCAAGAAGGCCAAGGAGGCGGCCAAGAACGCCGTCAAGAAGAACAAGCGCGTGCTCAAGGG
CTCCGTCAAGGACGCCAACTACTTCGCCCCCGCCGGCGCCGACGCCTCGCCCGCCCAGATCGACGCCGTCCTCGG
CGACGTCGAGCTCATCCAGGCCAAGATGGAGCCGGACGAGATCGCGGCCCTGGCCGCCAGCCTCGGCGGCCTGAG
CCTCGCCGCCGACATCAAGGCCGCCTGGGGCGCCGAGCTCGCCCGCCTCGTCGCCGCCGGCAAGCTCAAGCAGGG
CGACGCCAAGACGCTGCAGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail