Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2550
Gene name
LocationContig_161:15151..19997
Strand+
Gene length (bp)4846
Transcript length (bp)3960
Coding sequence length (bp)3960
Protein length (aa) 1320

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 1.2E-41 73 346
PF00664 ABC_membrane ABC transporter transmembrane region 2.0E-45 731 995
PF00005 ABC_tran ABC transporter 3.1E-29 415 573
PF00005 ABC_tran ABC transporter 1.5E-31 1080 1242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 58 1316 0.0E+00
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 56 1313 0.0E+00
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 59 1309 0.0E+00
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 56 1313 0.0E+00
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 56 1313 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2 58 1316 0.0E+00
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 56 1313 0.0E+00
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 59 1309 0.0E+00
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 56 1313 0.0E+00
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 56 1313 0.0E+00
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 59 1309 0.0E+00
sp|P21439|MDR3_HUMAN Phosphatidylcholine translocator ABCB4 OS=Homo sapiens GN=ABCB4 PE=1 SV=2 56 1313 0.0E+00
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 12 1313 0.0E+00
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 59 1309 0.0E+00
sp|P34712|PGP1_CAEEL Multidrug resistance protein pgp-1 OS=Caenorhabditis elegans GN=pgp-1 PE=1 SV=2 58 1317 0.0E+00
sp|Q08201|MDR3_RAT Phosphatidylcholine translocator ABCB4 OS=Rattus norvegicus GN=Abcb4 PE=1 SV=1 14 1313 0.0E+00
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 14 1313 0.0E+00
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 57 1309 0.0E+00
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 57 1314 0.0E+00
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 52 1309 0.0E+00
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 53 1309 0.0E+00
sp|Q9LJX0|AB19B_ARATH ABC transporter B family member 19 OS=Arabidopsis thaliana GN=ABCB19 PE=1 SV=1 56 1316 0.0E+00
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 58 1309 0.0E+00
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 44 1308 0.0E+00
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 58 1306 0.0E+00
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 77 1311 0.0E+00
sp|Q9LHD1|AB15B_ARATH ABC transporter B family member 15 OS=Arabidopsis thaliana GN=ABCB15 PE=3 SV=1 42 1313 0.0E+00
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 58 1306 0.0E+00
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 58 1306 0.0E+00
sp|P34713|PGP3_CAEEL Multidrug resistance protein pgp-3 OS=Caenorhabditis elegans GN=pgp-3 PE=2 SV=2 49 1313 0.0E+00
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 37 1306 0.0E+00
sp|Q8LPK2|AB2B_ARATH ABC transporter B family member 2 OS=Arabidopsis thaliana GN=ABCB2 PE=1 SV=3 56 1309 0.0E+00
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 77 1311 0.0E+00
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 49 1312 0.0E+00
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 56 1311 0.0E+00
sp|Q9LSJ8|AB16B_ARATH ABC transporter B family member 16 OS=Arabidopsis thaliana GN=ABCB16 PE=2 SV=1 59 1317 0.0E+00
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 52 1309 0.0E+00
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 58 1306 0.0E+00
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 17 1313 0.0E+00
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 58 1309 0.0E+00
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 56 1311 0.0E+00
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 56 1312 0.0E+00
sp|Q00748|MDR65_DROME Multidrug resistance protein homolog 65 OS=Drosophila melanogaster GN=Mdr65 PE=1 SV=2 52 1312 0.0E+00
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 56 1311 0.0E+00
sp|Q9M0M2|AB9B_ARATH ABC transporter B family member 9 OS=Arabidopsis thaliana GN=ABCB9 PE=3 SV=2 44 1306 0.0E+00
sp|Q9N0V3|ABCBB_RABIT Bile salt export pump OS=Oryctolagus cuniculus GN=ABCB11 PE=2 SV=1 53 1313 0.0E+00
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 88 1298 4.0E-178
sp|Q06034|MDR1_LEIEN Multidrug resistance protein 1 OS=Leishmania enriettii GN=MDR1 PE=3 SV=1 13 1311 8.0E-169
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 73 1305 1.0E-127
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 191 1313 1.0E-112
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 12 643 3.0E-111
sp|Q54BT3|ABCB2_DICDI ABC transporter B family member 2 OS=Dictyostelium discoideum GN=abcB2 PE=3 SV=1 68 643 5.0E-100
sp|Q9M1Q9|AB21B_ARATH ABC transporter B family member 21 OS=Arabidopsis thaliana GN=ABCB21 PE=1 SV=2 76 641 2.0E-92
sp|P08183|MDR1_HUMAN Multidrug resistance protein 1 OS=Homo sapiens GN=ABCB1 PE=1 SV=3 781 1317 2.0E-91
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 80 641 2.0E-91
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 68 642 3.0E-91
sp|P21448|MDR1_CRIGR Multidrug resistance protein 1 OS=Cricetulus griseus GN=ABCB1 PE=1 SV=2 780 1317 3.0E-90
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 38 643 3.0E-90
sp|P06795|MDR1B_MOUSE Multidrug resistance protein 1B OS=Mus musculus GN=Abcb1b PE=1 SV=1 780 1317 4.0E-90
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 780 1317 6.0E-90
sp|P21447|MDR1A_MOUSE Multidrug resistance protein 1A OS=Mus musculus GN=Abcb1a PE=1 SV=3 728 1317 1.0E-89
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 780 1317 1.0E-89
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 1 641 2.0E-89
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 58 644 8.0E-89
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 58 644 1.0E-88
sp|P21449|MDR2_CRIGR Multidrug resistance protein 2 OS=Cricetulus griseus GN=PGY2 PE=2 SV=2 68 642 4.0E-88
sp|P21440|MDR3_MOUSE Phosphatidylcholine translocator ABCB4 OS=Mus musculus GN=Abcb4 PE=1 SV=2 678 1313 9.0E-88
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 44 640 6.0E-87
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 126 643 8.0E-87
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 801 1316 3.0E-86
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 79 640 3.0E-86
sp|P23174|MDR3_CRIGR Phosphatidylcholine translocator ABCB4 OS=Cricetulus griseus GN=ABCB4 PE=2 SV=1 678 1313 7.0E-86
sp|Q9SGY1|AB10B_ARATH ABC transporter B family member 10 OS=Arabidopsis thaliana GN=ABCB10 PE=1 SV=2 81 647 9.0E-86
sp|O80725|AB4B_ARATH ABC transporter B family member 4 OS=Arabidopsis thaliana GN=ABCB4 PE=1 SV=1 736 1312 1.0E-85
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 767 1309 2.0E-85
sp|Q8T9W4|ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum GN=abcB3 PE=3 SV=1 737 1313 3.0E-85
sp|Q6YUU5|MDR_ORYSJ Putative multidrug resistance protein OS=Oryza sativa subsp. japonica GN=Os02g0190300 PE=3 SV=1 762 1315 8.0E-85
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 46 1309 1.0E-84
sp|P43245|MDR1_RAT Multidrug resistance protein 1 OS=Rattus norvegicus GN=Abcb1 PE=2 SV=1 68 642 2.0E-84
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 798 1316 1.0E-83
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 769 1312 6.0E-83
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 801 1315 6.0E-83
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 801 1315 1.0E-82
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 801 1315 7.0E-82
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 64 644 3.0E-81
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 801 1315 8.0E-81
sp|B5X0E4|ABCB5_MOUSE ATP-binding cassette sub-family B member 5 OS=Mus musculus GN=Abcb5 PE=2 SV=1 56 643 1.0E-80
sp|Q2M3G0|ABCB5_HUMAN ATP-binding cassette sub-family B member 5 OS=Homo sapiens GN=ABCB5 PE=1 SV=4 56 645 1.0E-80
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 115 643 1.0E-80
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 707 1312 4.0E-80
sp|Q9SYI3|AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana GN=ABCB5 PE=3 SV=1 801 1318 1.0E-79
sp|Q54W24|ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum GN=abcB4 PE=3 SV=1 801 1309 2.0E-79
sp|Q9LSJ6|AB17B_ARATH ABC transporter B family member 17 OS=Arabidopsis thaliana GN=ABCB17 PE=3 SV=1 725 1319 8.0E-78
sp|Q00449|MDR49_DROME Multidrug resistance protein homolog 49 OS=Drosophila melanogaster GN=Mdr49 PE=2 SV=2 717 1314 2.0E-77
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 67 643 4.0E-77
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 67 643 4.0E-77
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 67 643 4.0E-77
sp|O95342|ABCBB_HUMAN Bile salt export pump OS=Homo sapiens GN=ABCB11 PE=1 SV=2 759 1318 5.0E-77
sp|Q9FWX7|AB11B_ARATH ABC transporter B family member 11 OS=Arabidopsis thaliana GN=ABCB11 PE=2 SV=1 730 1317 6.0E-77
sp|Q9FHF1|AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana GN=ABCB7 PE=3 SV=1 731 1319 7.0E-77
sp|Q9C7F8|AB13B_ARATH ABC transporter B family member 13 OS=Arabidopsis thaliana GN=ABCB13 PE=3 SV=1 732 1317 1.0E-76
sp|Q9FWX8|AB12B_ARATH ABC transporter B family member 12 OS=Arabidopsis thaliana GN=ABCB12 PE=2 SV=2 730 1316 1.0E-76
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 67 643 1.0E-76
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 67 643 1.0E-76
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 67 643 1.0E-76
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 67 643 1.0E-76
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 67 643 1.0E-76
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 737 1319 2.0E-76
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 66 643 2.0E-76
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 67 643 2.0E-76
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 68 645 3.0E-76
sp|Q9QY30|ABCBB_MOUSE Bile salt export pump OS=Mus musculus GN=Abcb11 PE=1 SV=2 780 1313 6.0E-76
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 115 643 6.0E-76
sp|Q9C7F2|AB14B_ARATH ABC transporter B family member 14 OS=Arabidopsis thaliana GN=ABCB14 PE=3 SV=1 732 1312 2.0E-75
sp|Q5RKI8|ABCB8_RAT ATP-binding cassette sub-family B member 8, mitochondrial OS=Rattus norvegicus GN=Abcb8 PE=2 SV=1 72 661 2.0E-75
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 31 666 3.0E-75
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 45 643 3.0E-75
sp|Q9ZR72|AB1B_ARATH ABC transporter B family member 1 OS=Arabidopsis thaliana GN=ABCB1 PE=1 SV=1 123 657 4.0E-75
sp|Q9SYI2|AB3B_ARATH ABC transporter B family member 3 OS=Arabidopsis thaliana GN=ABCB3 PE=3 SV=1 736 1317 7.0E-75
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 147 643 2.0E-74
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 147 643 2.0E-74
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 147 643 2.0E-74
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 147 643 2.0E-74
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 112 645 7.0E-74
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 121 643 9.0E-74
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 67 643 1.0E-73
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 67 643 1.0E-73
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 140 643 1.0E-73
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 67 643 1.0E-73
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 67 643 2.0E-73
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 62 644 6.0E-73
sp|Q9CXJ4|ABCB8_MOUSE ATP-binding cassette sub-family B member 8, mitochondrial OS=Mus musculus GN=Abcb8 PE=1 SV=1 88 660 6.0E-73
sp|O70127|ABCBB_RAT Bile salt export pump OS=Rattus norvegicus GN=Abcb11 PE=1 SV=1 801 1313 1.0E-72
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 717 1308 1.0E-72
sp|B2GUP8|ABCB8_XENTR ATP-binding cassette sub-family B member 8, mitochondrial OS=Xenopus tropicalis GN=abcb8 PE=2 SV=1 801 1319 3.0E-72
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 111 645 9.0E-72
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 147 643 1.0E-71
sp|Q0WML0|AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana GN=ABCB27 PE=1 SV=1 780 1312 7.0E-71
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 659 1312 2.0E-70
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 147 643 3.0E-70
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 801 1312 3.0E-70
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 111 643 5.0E-70
sp|Q9LHK4|AB8B_ARATH Putative ABC transporter B family member 8 OS=Arabidopsis thaliana GN=ABCB8 PE=5 SV=1 736 1312 5.0E-70
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 147 646 2.0E-69
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 147 646 2.0E-69
sp|Q9NUT2|ABCB8_HUMAN ATP-binding cassette sub-family B member 8, mitochondrial OS=Homo sapiens GN=ABCB8 PE=1 SV=3 88 645 2.0E-69
sp|Q5RFQ9|ABCB8_PONAB ATP-binding cassette sub-family B member 8, mitochondrial OS=Pongo abelii GN=ABCB8 PE=2 SV=1 88 645 4.0E-69
sp|Q9JI39|ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus GN=Abcb10 PE=1 SV=1 794 1314 7.0E-69
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 747 1319 1.0E-68
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 147 643 1.0E-68
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 147 646 2.0E-68
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 151 643 2.0E-68
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 714 1312 3.0E-68
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 746 1317 6.0E-68
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 42 643 6.0E-68
sp|Q56A55|ABCB8_DANRE ATP-binding cassette sub-family B member 8, mitochondrial OS=Danio rerio GN=abcb8 PE=2 SV=1 112 643 1.0E-67
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 73 643 1.0E-67
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 717 1308 2.0E-67
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 746 1317 3.0E-67
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 121 643 6.0E-67
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 723 1305 7.0E-67
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 774 1314 1.0E-66
sp|Q1QX69|MSBA_CHRSD Lipid A export ATP-binding/permease protein MsbA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=msbA PE=3 SV=1 722 1305 1.0E-66
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 151 643 2.0E-66
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 768 1305 2.0E-66
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 127 643 4.0E-66
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 150 644 5.0E-66
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 121 643 7.0E-66
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 791 1312 4.0E-65
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 722 1315 5.0E-65
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 127 643 5.0E-65
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 686 1298 6.0E-65
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 124 643 6.0E-65
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 150 653 7.0E-65
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 87 643 7.0E-65
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 11 648 1.0E-64
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 127 639 2.0E-64
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 768 1314 3.0E-64
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 768 1314 3.0E-64
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 768 1314 3.0E-64
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 768 1314 3.0E-64
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 768 1314 3.0E-64
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 768 1314 3.0E-64
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 768 1314 3.0E-64
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 768 1314 3.0E-64
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 768 1314 3.0E-64
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 67 643 4.0E-64
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 118 643 5.0E-64
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 87 643 7.0E-64
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 87 643 7.0E-64
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 126 643 9.0E-64
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 305 1314 9.0E-64
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 128 639 1.0E-63
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 791 1312 1.0E-63
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 126 646 2.0E-63
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 128 653 2.0E-63
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 58 643 3.0E-63
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 147 643 3.0E-63
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 151 643 3.0E-63
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 24 643 3.0E-63
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 120 643 4.0E-63
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 128 653 8.0E-63
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 58 643 9.0E-63
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 770 1305 2.0E-62
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 769 1319 2.0E-62
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 124 643 2.0E-62
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 128 639 2.0E-62
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 78 643 4.0E-62
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 151 643 4.0E-62
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 128 643 5.0E-62
sp|Q8LPQ6|AB28B_ARATH ABC transporter B family member 28 OS=Arabidopsis thaliana GN=ABCB28 PE=2 SV=1 1061 1317 6.0E-62
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 126 647 8.0E-62
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 128 643 1.0E-61
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 128 648 2.0E-61
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 128 648 4.0E-61
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 126 645 6.0E-61
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 128 642 6.0E-61
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 128 642 6.0E-61
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 128 642 6.0E-61
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 128 642 6.0E-61
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 786 1312 1.0E-60
sp|Q4FS42|MSBA_PSYA2 Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=msbA PE=3 SV=1 722 1308 1.0E-60
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 722 1308 1.0E-60
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 381 1308 1.0E-60
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 87 643 2.0E-60
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 67 643 2.0E-60
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 127 643 6.0E-60
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 67 646 7.0E-60
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 127 639 1.0E-59
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 127 639 1.0E-59
sp|Q9M3B9|AB20B_ARATH ABC transporter B family member 20 OS=Arabidopsis thaliana GN=ABCB20 PE=1 SV=1 809 1309 1.0E-59
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 58 1303 2.0E-59
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 68 643 2.0E-59
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 134 639 2.0E-59
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 762 1317 3.0E-59
sp|Q1QBW0|MSBA_PSYCK Lipid A export ATP-binding/permease protein MsbA OS=Psychrobacter cryohalolentis (strain K5) GN=msbA PE=3 SV=1 722 1308 6.0E-59
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 121 643 6.0E-59
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 127 639 6.0E-59
sp|P97998|MDL1_CANAX ATP-dependent permease MDL1 OS=Candida albicans GN=MDL1 PE=3 SV=1 7 645 8.0E-59
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 58 643 1.0E-58
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 128 637 1.0E-58
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 114 639 1.0E-58
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 114 639 2.0E-58
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 114 639 2.0E-58
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 56 643 3.0E-58
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 152 643 3.0E-58
sp|Q6LPK6|MSBA_PHOPR Lipid A export ATP-binding/permease protein MsbA OS=Photobacterium profundum GN=msbA PE=3 SV=1 754 1305 3.0E-58
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 114 639 4.0E-58
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 134 639 4.0E-58
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 114 639 5.0E-58
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 114 639 5.0E-58
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 415 1300 5.0E-58
sp|P33311|MDL2_YEAST ATP-dependent permease MDL2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL2 PE=1 SV=3 139 663 7.0E-58
sp|Q2NUA5|MSBA_SODGM Lipid A export ATP-binding/permease protein MsbA OS=Sodalis glossinidius (strain morsitans) GN=msbA PE=3 SV=1 776 1305 1.0E-57
sp|Q5E0F2|MSBA_VIBF1 Lipid A export ATP-binding/permease protein MsbA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=msbA PE=3 SV=1 770 1305 1.0E-57
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 127 639 1.0E-57
sp|Q9KQW9|MSBA_VIBCH Lipid A export ATP-binding/permease protein MsbA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=msbA PE=1 SV=1 770 1305 2.0E-57
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 51 643 2.0E-57
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 147 641 2.0E-57
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 359 645 4.0E-57
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 359 645 4.0E-57
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 359 645 4.0E-57
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 359 645 4.0E-57
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 359 645 4.0E-57
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 359 645 4.0E-57
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 359 645 4.0E-57
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 359 645 4.0E-57
sp|Q8LPT1|AB6B_ARATH ABC transporter B family member 6 OS=Arabidopsis thaliana GN=ABCB6 PE=1 SV=2 809 1309 4.0E-57
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 415 1300 4.0E-57
sp|Q8DAV2|MSBA_VIBVU Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain CMCP6) GN=msbA PE=3 SV=1 767 1305 5.0E-57
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 350 645 6.0E-57
sp|Q9WYC4|Y288_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0288 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0288 PE=1 SV=1 792 1312 1.0E-56
sp|Q7MJ07|MSBA_VIBVY Lipid A export ATP-binding/permease protein MsbA OS=Vibrio vulnificus (strain YJ016) GN=msbA PE=3 SV=2 767 1305 2.0E-56
sp|Q3SFZ6|MSBA_THIDA Lipid A export ATP-binding/permease protein MsbA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=msbA PE=3 SV=1 701 1308 2.0E-56
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 415 1300 3.0E-56
sp|Q9CHL8|LMRA_LACLA Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lmrA PE=1 SV=2 150 643 5.0E-56
sp|Q87R16|MSBA_VIBPA Lipid A export ATP-binding/permease protein MsbA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=msbA PE=3 SV=1 769 1305 5.0E-56
sp|Q3KJ31|MSBA_PSEPF Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf0-1) GN=msbA PE=3 SV=1 801 1305 5.0E-56
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 147 643 6.0E-56
sp|Q66CI3|MSBA_YERPS Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=msbA PE=3 SV=1 754 1305 6.0E-56
sp|Q1CGH0|MSBA_YERPN Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=msbA PE=3 SV=1 754 1305 6.0E-56
sp|Q8ZGA9|MSBA_YERPE Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis GN=msbA PE=3 SV=1 754 1305 6.0E-56
sp|Q1CA68|MSBA_YERPA Lipid A export ATP-binding/permease protein MsbA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=msbA PE=3 SV=1 754 1305 6.0E-56
sp|Q7NZU6|MSBA_CHRVO Lipid A export ATP-binding/permease protein MsbA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=msbA PE=3 SV=1 725 1305 7.0E-56
sp|P97046|LMRA_LACLM Multidrug resistance ABC transporter ATP-binding and permease protein OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lmrA PE=3 SV=3 150 643 7.0E-56
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 53 643 8.0E-56
sp|O06967|BMRA_BACSU Multidrug resistance ABC transporter ATP-binding/permease protein BmrA OS=Bacillus subtilis (strain 168) GN=bmrA PE=1 SV=1 138 643 1.0E-55
sp|Q6F9X0|MSBA_ACIAD Lipid A export ATP-binding/permease protein MsbA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=msbA PE=3 SV=1 167 639 1.0E-55
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 747 1309 1.0E-55
sp|P35598|EXP8_STRPN Putative ABC transporter ATP-binding protein exp8 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp8 PE=3 SV=3 761 1308 2.0E-55
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 196 643 2.0E-55
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 413 1303 2.0E-55
sp|P55469|Y4GM_RHISN Uncharacterized ABC transporter ATP-binding protein y4gM OS=Rhizobium sp. (strain NGR234) GN=NGR_a03510 PE=3 SV=1 768 1305 3.0E-55
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 334 643 4.0E-55
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 97 642 4.0E-55
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 97 642 4.0E-55
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 97 642 4.0E-55
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 144 641 4.0E-55
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 790 1308 5.0E-55
sp|Q8XXB6|MSBA_RALSO Lipid A export ATP-binding/permease protein MsbA OS=Ralstonia solanacearum (strain GMI1000) GN=msbA PE=3 SV=1 787 1305 6.0E-55
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 120 643 6.0E-55
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 196 643 1.0E-54
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 196 643 1.0E-54
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 127 639 1.0E-54
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 86 643 1.0E-54
sp|P63359|MSBA_SALTY Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=msbA PE=1 SV=1 776 1305 2.0E-54
sp|P63360|MSBA_SALTI Lipid A export ATP-binding/permease protein MsbA OS=Salmonella typhi GN=msbA PE=3 SV=1 776 1305 2.0E-54
sp|Q57R14|MSBA_SALCH Lipid A export ATP-binding/permease protein MsbA OS=Salmonella choleraesuis (strain SC-B67) GN=msbA PE=3 SV=1 776 1305 2.0E-54
sp|Q5PGH0|MSBA_SALPA Lipid A export ATP-binding/permease protein MsbA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=msbA PE=3 SV=1 776 1305 2.0E-54
sp|Q6D437|MSBA_PECAS Lipid A export ATP-binding/permease protein MsbA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=msbA PE=3 SV=2 770 1305 2.0E-54
sp|P71082|YGAD_BACSU Putative multidrug export ATP-binding/permease protein YgaD OS=Bacillus subtilis (strain 168) GN=ygaD PE=3 SV=2 334 646 2.0E-54
sp|Q9HUG8|MSBA_PSEAE Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=msbA PE=3 SV=1 801 1318 2.0E-54
sp|P23702|LTXB_AGGAC Leukotoxin export ATP-binding protein LtxB OS=Aggregatibacter actinomycetemcomitans GN=ltxB PE=1 SV=1 865 1305 2.0E-54
sp|P26760|RTX1B_ACTPL Toxin RTX-I translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIB PE=1 SV=2 865 1313 2.0E-54
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 726 1298 2.0E-54
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 117 642 2.0E-54
sp|Q83LP0|MSBA_SHIFL Lipid A export ATP-binding/permease protein MsbA OS=Shigella flexneri GN=msbA PE=3 SV=1 776 1305 3.0E-54
sp|Q0VQP5|MSBA_ALCBS Lipid A export ATP-binding/permease protein MsbA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=msbA PE=3 SV=1 128 641 3.0E-54
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 3.0E-54
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 200 647 3.0E-54
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 126 643 4.0E-54
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 747 1305 4.0E-54
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 792 1314 4.0E-54
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 4.0E-54
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 4.0E-54
sp|Q3IGX5|MSBA_PSEHT Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=msbA PE=3 SV=1 731 1305 4.0E-54
sp|Q32E34|MSBA_SHIDS Lipid A export ATP-binding/permease protein MsbA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=msbA PE=3 SV=1 776 1305 4.0E-54
sp|Q31YT6|MSBA_SHIBS Lipid A export ATP-binding/permease protein MsbA OS=Shigella boydii serotype 4 (strain Sb227) GN=msbA PE=3 SV=1 776 1305 4.0E-54
sp|P60752|MSBA_ECOLI Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain K12) GN=msbA PE=1 SV=1 776 1305 4.0E-54
sp|P60753|MSBA_ECO57 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O157:H7 GN=msbA PE=3 SV=1 776 1305 4.0E-54
sp|Q3Z3K7|MSBA_SHISS Lipid A export ATP-binding/permease protein MsbA OS=Shigella sonnei (strain Ss046) GN=msbA PE=3 SV=1 776 1305 4.0E-54
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 126 643 4.0E-54
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 773 1305 4.0E-54
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 747 1305 4.0E-54
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 5.0E-54
sp|Q7N6C6|MSBA_PHOLL Lipid A export ATP-binding/permease protein MsbA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=msbA PE=3 SV=1 776 1305 5.0E-54
sp|Q87VF3|MSBA_PSESM Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=msbA PE=3 SV=2 801 1318 5.0E-54
sp|Q1RDU4|MSBA_ECOUT Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli (strain UTI89 / UPEC) GN=msbA PE=3 SV=1 776 1305 5.0E-54
sp|Q8FJB1|MSBA_ECOL6 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=msbA PE=3 SV=1 776 1305 5.0E-54
sp|Q0TJD9|MSBA_ECOL5 Lipid A export ATP-binding/permease protein MsbA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=msbA PE=3 SV=1 776 1305 5.0E-54
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 6.0E-54
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 126 643 6.0E-54
sp|Q080T2|MSBA_SHEFN Lipid A export ATP-binding/permease protein MsbA OS=Shewanella frigidimarina (strain NCIMB 400) GN=msbA PE=3 SV=1 769 1312 6.0E-54
sp|Q4ZZ16|MSBA_PSEU2 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=msbA PE=3 SV=1 801 1318 6.0E-54
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 7.0E-54
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 381 1296 7.0E-54
sp|Q4KJB2|MSBA_PSEF5 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=msbA PE=3 SV=1 801 1318 8.0E-54
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 329 643 1.0E-53
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 144 619 1.0E-53
sp|P55122|LKTB_PASSP Leukotoxin translocation ATP-binding protein LktB OS=Pasteurella haemolytica-like sp. (strain 5943B) GN=lktB PE=3 SV=1 865 1305 1.0E-53
sp|P0C086|LKTB7_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 2.0E-53
sp|P0C087|LKB14_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 2.0E-53
sp|Q93FH6|LKB1B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 2.0E-53
sp|Q93FH2|LKB13_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 2.0E-53
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 747 1309 2.0E-53
sp|Q48P40|MSBA_PSE14 Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=msbA PE=3 SV=2 801 1318 2.0E-53
sp|P16532|LKB1A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 2.0E-53
sp|Q93FH0|LKB2A_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=2 865 1305 2.0E-53
sp|Q933I3|LKTB_MANGL Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia glucosida GN=lktB PE=3 SV=1 865 1305 3.0E-53
sp|Q933E0|LKTB_BIBTR Leukotoxin translocation ATP-binding protein LktB OS=Bibersteinia trehalosi GN=lktB PE=3 SV=1 865 1305 3.0E-53
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 801 1303 3.0E-53
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 166 642 4.0E-53
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 786 1305 4.0E-53
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 395 665 5.0E-53
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 5.0E-53
sp|P36372|TAP2_RAT Antigen peptide transporter 2 OS=Rattus norvegicus GN=Tap2 PE=2 SV=1 801 1309 5.0E-53
sp|Q8D2U8|MSBA_WIGBR Lipid A export ATP-binding/permease protein MsbA OS=Wigglesworthia glossinidia brevipalpis GN=msbA PE=3 SV=1 779 1312 5.0E-53
sp|O31707|YKNU_BACSU Uncharacterized ABC transporter ATP-binding protein YknU OS=Bacillus subtilis (strain 168) GN=yknU PE=3 SV=3 816 1308 5.0E-53
sp|Q93FH3|LKB16_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 865 1305 6.0E-53
sp|Q93FG6|LKB2B_MANHA Leukotoxin translocation ATP-binding protein LktB OS=Mannheimia haemolytica GN=lktB PE=3 SV=1 126 643 7.0E-53
sp|Q4QPI4|MSBA_HAEI8 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain 86-028NP) GN=msbA PE=3 SV=1 726 1311 7.0E-53
sp|Q47908|MSBA_FRANO Lipid A export ATP-binding/permease protein MsbA OS=Francisella novicida GN=msbA PE=3 SV=2 769 1305 8.0E-53
sp|P47261|Y015_MYCGE Putative ABC transporter ATP-binding protein MG015 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG015 PE=3 SV=1 118 639 8.0E-53
sp|Q46Y89|MSBA_CUPPJ Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=msbA PE=3 SV=1 774 1305 9.0E-53
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 140 642 1.0E-52
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 786 1305 1.0E-52
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 774 1305 1.0E-52
sp|Q28433|TAP1_GORGO Antigen peptide transporter 1 OS=Gorilla gorilla gorilla GN=TAP1 PE=2 SV=2 128 642 1.0E-52
sp|Q4HVU7|ATM1_GIBZE Iron-sulfur clusters transporter ATM1, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=ATM1 PE=3 SV=1 788 1312 2.0E-52
sp|Q0A4U4|MSBA_ALKEH Lipid A export ATP-binding/permease protein MsbA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=msbA PE=3 SV=1 770 1305 2.0E-52
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 196 643 2.0E-52
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 196 643 2.0E-52
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 722 1305 2.0E-52
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 196 643 2.0E-52
sp|Q0I4C5|MSBA_HAES1 Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus somnus (strain 129Pt) GN=msbA PE=3 SV=1 769 1312 2.0E-52
sp|Q46717|HLYB_ECO57 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O157:H7 GN=hlyB PE=3 SV=2 887 1306 3.0E-52
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 865 1314 3.0E-52
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 196 643 3.0E-52
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 133 657 3.0E-52
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 133 657 3.0E-52
sp|Q83D84|MSBA_COXBU Lipid A export ATP-binding/permease protein MsbA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=msbA PE=3 SV=1 769 1319 3.0E-52
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 133 657 3.0E-52
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 697 1312 3.0E-52
sp|Q5NIG3|MSBA_FRATT Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=msbA PE=3 SV=1 769 1305 3.0E-52
sp|Q14JW6|MSBA_FRAT1 Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=msbA PE=1 SV=1 769 1305 3.0E-52
sp|Q0BKJ3|MSBA_FRATO Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=msbA PE=3 SV=1 769 1305 3.0E-52
sp|Q2A1U9|MSBA_FRATH Lipid A export ATP-binding/permease protein MsbA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=msbA PE=3 SV=1 769 1305 3.0E-52
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 774 1305 4.0E-52
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 788 1314 5.0E-52
sp|Q03518|TAP1_HUMAN Antigen peptide transporter 1 OS=Homo sapiens GN=TAP1 PE=1 SV=2 126 642 6.0E-52
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 46 643 6.0E-52
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 46 643 6.0E-52
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 46 643 6.0E-52
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 397 1303 7.0E-52
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 196 643 7.0E-52
sp|Q12M46|MSBA_SHEDO Lipid A export ATP-binding/permease protein MsbA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=msbA PE=3 SV=1 770 1305 7.0E-52
sp|P33310|MDL1_YEAST ATP-dependent permease MDL1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDL1 PE=1 SV=2 139 656 7.0E-52
sp|Q1LQD3|MSBA_CUPMC Lipid A export ATP-binding/permease protein MsbA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=msbA PE=3 SV=1 151 643 8.0E-52
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 393 1301 8.0E-52
sp|Q9Y7M7|MDL1_SCHPO ATP-dependent permease MDL1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdl1 PE=3 SV=1 56 647 8.0E-52
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 205 643 9.0E-52
sp|Q1RJ91|Y492_RICBR Putative export ATP-binding/permease protein RBE_0492 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0492 PE=3 SV=1 134 645 1.0E-51
sp|P10089|HLYBC_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=3 SV=2 865 1300 1.0E-51
sp|Q63VX7|MSBA_BURPS Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain K96243) GN=msbA PE=3 SV=1 774 1305 1.0E-51
sp|Q3JUI6|MSBA_BURP1 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia pseudomallei (strain 1710b) GN=msbA PE=3 SV=2 774 1305 1.0E-51
sp|Q62IG3|MSBA_BURMA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia mallei (strain ATCC 23344) GN=msbA PE=3 SV=2 774 1305 1.0E-51
sp|Q3J7R8|MSBA_NITOC Lipid A export ATP-binding/permease protein MsbA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=msbA PE=3 SV=1 717 1305 1.0E-51
sp|Q60AA3|MSBA_METCA Lipid A export ATP-binding/permease protein MsbA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=msbA PE=3 SV=1 1083 1312 1.0E-51
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 786 1312 2.0E-51
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 766 1312 2.0E-51
sp|Q483B6|MSBA1_COLP3 Lipid A export ATP-binding/permease protein MsbA 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA1 PE=3 SV=1 766 1305 2.0E-51
sp|P75094|Y019_MYCPN Putative ABC transporter ATP-binding protein MG015 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_019 PE=3 SV=1 773 1305 3.0E-51
sp|P08716|HLYBP_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 865 1300 3.0E-51
sp|Q47258|HLYB3_ECOLX Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli GN=hlyB PE=1 SV=1 865 1300 3.0E-51
sp|Q9RCG7|PAXB_PASAE Exotoxin translocation ATP-binding protein PaxB OS=Pasteurella aerogenes GN=paxB PE=3 SV=1 385 645 3.0E-51
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 389 639 3.0E-51
sp|Q492S9|MSBA_BLOPB Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia pennsylvanicus (strain BPEN) GN=msbA PE=3 SV=1 776 1305 3.0E-51
sp|Q8FDZ8|HLYB_ECOL6 Alpha-hemolysin translocation ATP-binding protein HlyB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hlyB PE=3 SV=1 865 1300 4.0E-51
sp|Q9CMG7|MSBA_PASMU Lipid A export ATP-binding/permease protein MsbA OS=Pasteurella multocida (strain Pm70) GN=msbA PE=3 SV=1 769 1308 5.0E-51
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 196 643 5.0E-51
sp|Q21WN9|MSBA_RHOFT Lipid A export ATP-binding/permease protein MsbA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=msbA PE=3 SV=1 722 1306 5.0E-51
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 111 643 7.0E-51
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 1051 1313 1.0E-50
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 210 643 1.0E-50
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 210 643 1.0E-50
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 210 643 1.0E-50
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 397 1300 1.0E-50
sp|P36370|TAP1_RAT Antigen peptide transporter 1 OS=Rattus norvegicus GN=Tap1 PE=1 SV=2 803 1309 1.0E-50
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 46 643 2.0E-50
sp|Q8RY46|AB26B_ARATH ABC transporter B family member 26, chloroplastic OS=Arabidopsis thaliana GN=ABCB26 PE=2 SV=1 770 1313 2.0E-50
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 866 1319 2.0E-50
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 135 643 2.0E-50
sp|O31708|YKNV_BACSU Uncharacterized ABC transporter ATP-binding protein YknV OS=Bacillus subtilis (strain 168) GN=yknV PE=3 SV=1 769 1312 4.0E-50
sp|Q04473|RTX3B_ACTPL Toxin RTX-III translocation ATP-binding protein OS=Actinobacillus pleuropneumoniae GN=apxIIIB PE=3 SV=1 865 1313 5.0E-50
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 1012 1319 5.0E-50
sp|Q7VWD8|MSBA_BORPE Lipid A export ATP-binding/permease protein MsbA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=msbA PE=3 SV=1 725 1308 6.0E-50
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 867 1318 6.0E-50
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 395 675 6.0E-50
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 395 669 6.0E-50
sp|Q7W9N7|MSBA_BORPA Lipid A export ATP-binding/permease protein MsbA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=msbA PE=3 SV=1 725 1308 7.0E-50
sp|Q7WH20|MSBA_BORBR Lipid A export ATP-binding/permease protein MsbA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=msbA PE=3 SV=2 725 1308 7.0E-50
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 388 657 7.0E-50
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 478 1312 7.0E-50
sp|P21958|TAP1_MOUSE Antigen peptide transporter 1 OS=Mus musculus GN=Tap1 PE=1 SV=3 801 1309 8.0E-50
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 395 644 8.0E-50
sp|Q5P2S7|MSBA_AROAE Lipid A export ATP-binding/permease protein MsbA OS=Aromatoleum aromaticum (strain EbN1) GN=msbA PE=3 SV=1 801 1305 8.0E-50
sp|Q65U21|MSBA_MANSM Lipid A export ATP-binding/permease protein MsbA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=msbA PE=3 SV=2 764 1308 1.0E-49
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 395 644 1.0E-49
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 411 1309 1.0E-49
sp|P63398|Y1303_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1303c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1303c PE=3 SV=1 790 1308 1.0E-49
sp|P9WQJ3|Y1272_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1272c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1272c PE=1 SV=1 790 1308 1.0E-49
sp|P9WQJ2|Y1272_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1310 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1310 PE=3 SV=1 790 1308 1.0E-49
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 791 1312 2.0E-49
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 788 1306 2.0E-49
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 788 1306 2.0E-49
sp|P13568|MDR_PLAFF Multidrug resistance protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) GN=MDR1 PE=3 SV=1 72 641 2.0E-49
sp|Q47JR8|MSBA_DECAR Lipid A export ATP-binding/permease protein MsbA OS=Dechloromonas aromatica (strain RCB) GN=msbA PE=3 SV=1 714 1305 2.0E-49
sp|P0DKX6|CYAB_BORP1 Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain ATCC 9797 / DSM 5571 / NCTC 10739 / 18323) GN=cyaB PE=3 SV=1 123 643 2.0E-49
sp|P0DKX5|CYAB_BORPE Cyclolysin secretion/processing ATP-binding protein CyaB OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cyaB PE=3 SV=1 123 643 3.0E-49
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 140 643 3.0E-49
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 313 646 3.0E-49
sp|P44407|MSBA_HAEIN Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=msbA PE=3 SV=1 726 1308 3.0E-49
sp|O07549|YHEH_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheH OS=Bacillus subtilis (strain 168) GN=yheH PE=1 SV=1 793 1308 4.0E-49
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 865 1313 4.0E-49
sp|P11599|HLYB_PROVU Alpha-hemolysin translocation ATP-binding protein HlyB OS=Proteus vulgaris GN=hlyB PE=3 SV=1 196 643 5.0E-49
sp|O14286|ATM1_SCHPO Iron-sulfur clusters transporter atm1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atm1 PE=3 SV=2 395 651 6.0E-49
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 259 1309 6.0E-49
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 766 1312 6.0E-49
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 121 639 6.0E-49
sp|Q1GZI0|MSBA_METFK Lipid A export ATP-binding/permease protein MsbA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=msbA PE=3 SV=1 714 1312 7.0E-49
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 397 1311 8.0E-49
sp|P22638|HEPA_NOSS1 Heterocyst differentiation ATP-binding protein HepA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hepA PE=2 SV=3 151 643 1.0E-48
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 787 1308 1.0E-48
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 861 1319 1.0E-48
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 389 639 1.0E-48
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 205 643 1.0E-48
sp|Q88D92|MSBA_PSEPK Lipid A export ATP-binding/permease protein MsbA OS=Pseudomonas putida (strain KT2440) GN=msbA PE=3 SV=1 786 1318 1.0E-48
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 336 1308 2.0E-48
sp|Q2HIE9|ATM1_CHAGB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATM1 PE=3 SV=1 395 645 3.0E-48
sp|Q1BUV6|MSBA_BURCA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia cenocepacia (strain AU 1054) GN=msbA PE=3 SV=2 774 1305 3.0E-48
sp|Q9JW59|MSBA_NEIMA Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=msbA PE=3 SV=1 1046 1319 3.0E-48
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 867 1317 3.0E-48
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 867 1319 3.0E-48
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 66 646 3.0E-48
sp|P36371|TAP2_MOUSE Antigen peptide transporter 2 OS=Mus musculus GN=Tap2 PE=1 SV=1 801 1309 3.0E-48
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 397 1299 4.0E-48
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 717 1313 4.0E-48
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 395 670 5.0E-48
sp|Q142P6|MSBA_BURXL Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia xenovorans (strain LB400) GN=msbA PE=3 SV=1 152 643 6.0E-48
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 1046 1309 6.0E-48
sp|Q31FG2|MSBA_THICR Lipid A export ATP-binding/permease protein MsbA OS=Thiomicrospira crunogena (strain XCL-2) GN=msbA PE=3 SV=1 767 1305 8.0E-48
sp|Q5H0H0|MSBA_XANOR Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=msbA PE=3 SV=1 1090 1318 8.0E-48
sp|Q2P3E7|MSBA_XANOM Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=msbA PE=3 SV=1 1090 1318 8.0E-48
sp|Q39E73|MSBA_BURL3 Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=msbA PE=3 SV=2 774 1305 9.0E-48
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 395 644 1.0E-47
sp|Q5B1Q2|ATM1_EMENI Iron-sulfur clusters transporter atm1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atm1 PE=3 SV=2 788 1312 1.0E-47
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 912 1312 1.0E-47
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 368 661 1.0E-47
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 715 1305 2.0E-47
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 397 1308 2.0E-47
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 1046 1319 2.0E-47
sp|Q5ZUH9|MSBA_LEGPH Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=msbA PE=3 SV=2 722 1316 3.0E-47
sp|Q7RX59|ATM1_NEUCR Iron-sulfur clusters transporter atm1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fes-4 PE=3 SV=1 395 645 3.0E-47
sp|Q9PEE7|MSBA_XYLFA Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain 9a5c) GN=msbA PE=3 SV=1 696 1305 3.0E-47
sp|Q3SP57|NDVA_NITWN Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ndvA PE=3 SV=2 214 643 3.0E-47
sp|Q9JXR3|MSBA_NEIMB Lipid A export ATP-binding/permease protein MsbA OS=Neisseria meningitidis serogroup B (strain MC58) GN=msbA PE=3 SV=1 121 639 3.0E-47
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 1062 1313 3.0E-47
sp|Q5X498|MSBA_LEGPA Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Paris) GN=msbA PE=3 SV=1 792 1316 4.0E-47
sp|Q5F4X8|MSBA_NEIG1 Lipid A export ATP-binding/permease protein MsbA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=msbA PE=3 SV=1 111 639 5.0E-47
sp|Q9DC29|ABCB6_MOUSE ATP-binding cassette sub-family B member 6, mitochondrial OS=Mus musculus GN=Abcb6 PE=1 SV=1 1007 1317 5.0E-47
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 852 1319 5.0E-47
sp|Q7VR44|MSBA_BLOFL Lipid A export ATP-binding/permease protein MsbA OS=Blochmannia floridanus GN=msbA PE=3 SV=1 776 1305 6.0E-47
sp|Q15UY7|MSBA_PSEA6 Lipid A export ATP-binding/permease protein MsbA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=msbA PE=3 SV=1 766 1305 6.0E-47
sp|Q5WVN2|MSBA_LEGPL Lipid A export ATP-binding/permease protein MsbA OS=Legionella pneumophila (strain Lens) GN=msbA PE=3 SV=1 792 1316 6.0E-47
sp|Q2KYS6|MSBA_BORA1 Lipid A export ATP-binding/permease protein MsbA OS=Bordetella avium (strain 197N) GN=msbA PE=3 SV=1 725 1308 7.0E-47
sp|Q2ULH4|ATM1_ASPOR Iron-sulfur clusters transporter atm1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atm1 PE=3 SV=1 788 1314 9.0E-47
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 1053 1309 9.0E-47
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 715 1305 1.0E-46
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 1053 1309 1.0E-46
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 867 1317 1.0E-46
sp|Q87EF0|MSBA_XYLFT Lipid A export ATP-binding/permease protein MsbA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=msbA PE=3 SV=1 696 1305 2.0E-46
sp|Q57180|Y1051_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1051 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1051 PE=3 SV=1 1041 1313 2.0E-46
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 845 1308 2.0E-46
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 1083 1314 3.0E-46
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 845 1318 3.0E-46
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 132 643 3.0E-46
sp|Q7VL52|MSBA_HAEDU Lipid A export ATP-binding/permease protein MsbA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=msbA PE=3 SV=1 769 1312 3.0E-46
sp|Q8T9W2|ABCB5_DICDI ABC transporter B family member 5 OS=Dictyostelium discoideum GN=abcB5 PE=3 SV=1 856 1312 4.0E-46
sp|Q1QH37|NDVA_NITHX Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ndvA PE=3 SV=1 214 649 4.0E-46
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 397 1301 4.0E-46
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 1007 1312 5.0E-46
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 336 1308 5.0E-46
sp|P0CL92|ATM1_CRYNJ Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATM1 PE=3 SV=1 370 643 6.0E-46
sp|P0CL93|ATM1_CRYNB Iron-sulfur clusters transporter ATM1, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATM1 PE=3 SV=1 370 643 6.0E-46
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 1061 1308 6.0E-46
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 774 1312 6.0E-46
sp|Q8P8W4|MSBA_XANCP Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=msbA PE=3 SV=1 740 1318 8.0E-46
sp|Q4UV65|MSBA_XANC8 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=msbA PE=3 SV=1 740 1318 8.0E-46
sp|Q6N1Y7|NDVA_RHOPA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ndvA PE=3 SV=1 53 643 9.0E-46
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 348 643 9.0E-46
sp|Q03519|TAP2_HUMAN Antigen peptide transporter 2 OS=Homo sapiens GN=TAP2 PE=1 SV=1 801 1292 1.0E-45
sp|Q4UMZ3|Y214_RICFE Putative export ATP-binding/permease protein RF_0214 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0214 PE=3 SV=2 253 643 1.0E-45
sp|Q20Z38|NDVA_RHOPB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB18) GN=ndvA PE=3 SV=1 200 643 1.0E-45
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 120 643 1.0E-45
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 849 1317 1.0E-45
sp|Q0HTS8|MSBA_SHESR Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-7) GN=msbA PE=3 SV=1 769 1305 2.0E-45
sp|Q0HHH4|MSBA_SHESM Lipid A export ATP-binding/permease protein MsbA OS=Shewanella sp. (strain MR-4) GN=msbA PE=3 SV=1 769 1305 2.0E-45
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 381 671 2.0E-45
sp|Q3BTC8|MSBA_XANC5 Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=msbA PE=3 SV=1 1056 1318 3.0E-45
sp|Q8PKS5|MSBA_XANAC Lipid A export ATP-binding/permease protein MsbA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=msbA PE=3 SV=1 1056 1318 3.0E-45
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 381 671 3.0E-45
sp|Q54RU1|ABCB6_DICDI ABC transporter B family member 6 OS=Dictyostelium discoideum GN=abcB6 PE=3 SV=1 1023 1314 4.0E-45
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 836 1300 4.0E-45
sp|Q89UT8|NDVA_BRADU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ndvA PE=3 SV=1 90 643 4.0E-45
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 372 663 4.0E-45
sp|Q8EDF0|MSBA_SHEON Lipid A export ATP-binding/permease protein MsbA OS=Shewanella oneidensis (strain MR-1) GN=msbA PE=3 SV=1 769 1305 5.0E-45
sp|Q9NP58|ABCB6_HUMAN ATP-binding cassette sub-family B member 6, mitochondrial OS=Homo sapiens GN=ABCB6 PE=1 SV=1 368 663 5.0E-45
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 792 1305 6.0E-45
sp|P54683|TAGB_DICDI Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum GN=tagB PE=3 SV=2 1061 1308 9.0E-45
sp|P54718|YFIB_BACSU Uncharacterized ABC transporter ATP-binding protein YfiB OS=Bacillus subtilis (strain 168) GN=yfiB PE=3 SV=1 126 651 9.0E-45
sp|Q4WLN7|ATM1_ASPFU Iron-sulfur clusters transporter atm1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atm1 PE=3 SV=1 788 1317 1.0E-44
sp|O70595|ABCB6_RAT ATP-binding cassette sub-family B member 6, mitochondrial OS=Rattus norvegicus GN=Abcb6 PE=2 SV=1 368 647 1.0E-44
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 948 1317 1.0E-44
sp|A1USS5|NDVA_BARBK Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ndvA PE=3 SV=1 199 658 2.0E-44
sp|P70864|NDVA_BARBA Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella bacilliformis GN=ndvA PE=3 SV=2 199 660 2.0E-44
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 948 1317 2.0E-44
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 948 1317 2.0E-44
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 151 641 2.0E-44
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 1058 1309 2.0E-44
sp|P54719|YFIC_BACSU Uncharacterized ABC transporter ATP-binding protein YfiC OS=Bacillus subtilis (strain 168) GN=yfiC PE=3 SV=1 395 643 3.0E-44
sp|Q92GP9|Y1073_RICCN Putative export ATP-binding/permease protein RC1073 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC1073 PE=3 SV=1 253 643 3.0E-44
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 70 661 3.0E-44
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 392 656 3.0E-44
sp|Q07QX6|NDVA_RHOP5 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisA53) GN=ndvA PE=3 SV=1 200 643 4.0E-44
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 948 1317 4.0E-44
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 1057 1317 5.0E-44
sp|Q12C33|MSBA_POLSJ Lipid A export ATP-binding/permease protein MsbA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=msbA PE=3 SV=1 718 1308 5.0E-44
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 429 1308 5.0E-44
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 1055 1315 5.0E-44
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 480 1313 6.0E-44
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 948 1317 8.0E-44
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 948 1317 8.0E-44
sp|Q61102|ABCB7_MOUSE ATP-binding cassette sub-family B member 7, mitochondrial OS=Mus musculus GN=Abcb7 PE=1 SV=3 792 1313 1.0E-43
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 480 1313 1.0E-43
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 480 1313 1.0E-43
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 948 1309 1.0E-43
sp|Q6G2Z5|NDVA_BARHE Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ndvA PE=3 SV=1 199 659 2.0E-43
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 788 1308 2.0E-43
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 930 1305 2.0E-43
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 166 643 3.0E-43
sp|Q9ZCM8|Y696_RICPR Putative export ATP-binding/permease protein RP696 OS=Rickettsia prowazekii (strain Madrid E) GN=RP696 PE=3 SV=1 253 643 3.0E-43
sp|Q2J0F4|NDVA_RHOP2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain HaA2) GN=ndvA PE=3 SV=1 67 643 3.0E-43
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 166 643 3.0E-43
sp|Q68W42|Y691_RICTY Putative export ATP-binding/permease protein RT0691 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0691 PE=3 SV=1 253 643 4.0E-43
sp|Q6FZF2|NDVA_BARQU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Bartonella quintana (strain Toulouse) GN=ndvA PE=3 SV=1 199 653 5.0E-43
sp|O75027|ABCB7_HUMAN ATP-binding cassette sub-family B member 7, mitochondrial OS=Homo sapiens GN=ABCB7 PE=1 SV=2 792 1313 6.0E-43
sp|Q4PH16|ATM1_USTMA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATM1 PE=3 SV=1 395 661 8.0E-43
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 1055 1306 1.0E-42
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 214 671 1.0E-42
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 67 632 1.0E-42
sp|P0AAG5|MDLB_ECOLI Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli (strain K12) GN=mdlB PE=1 SV=1 790 1308 1.0E-42
sp|P0AAG6|MDLB_ECOL6 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdlB PE=3 SV=1 790 1308 1.0E-42
sp|P0AAG7|MDLB_ECO57 Multidrug resistance-like ATP-binding protein MdlB OS=Escherichia coli O157:H7 GN=mdlB PE=3 SV=1 790 1308 1.0E-42
sp|Q13BH6|NDVA_RHOPS Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhodopseudomonas palustris (strain BisB5) GN=ndvA PE=3 SV=1 67 643 1.0E-42
sp|Q704E8|ABCB7_RAT ATP-binding cassette sub-family B member 7, mitochondrial OS=Rattus norvegicus GN=Abcb7 PE=1 SV=1 792 1313 1.0E-42
sp|Q89A96|MDLB_BUCBP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlB PE=3 SV=1 1061 1314 2.0E-42
sp|Q08D64|ABCB6_XENTR ATP-binding cassette sub-family B member 6, mitochondrial OS=Xenopus tropicalis GN=abcb6 PE=2 SV=1 368 644 2.0E-42
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 348 643 3.0E-42
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 1061 1306 4.0E-42
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 948 1305 8.0E-42
sp|Q2G506|ATM1_NOVAD ATM1-type heavy metal exporter OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=atm1 PE=1 SV=1 369 643 8.0E-42
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 402 648 1.0E-41
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 402 648 1.0E-41
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 402 648 1.0E-41
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 68 645 1.0E-41
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 930 1305 1.0E-41
sp|P78966|MAM1_SCHPO Mating factor M secretion protein mam1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mam1 PE=3 SV=1 761 1319 1.0E-41
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 907 1309 2.0E-41
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 1055 1306 3.0E-41
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 397 649 5.0E-41
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 930 1305 5.0E-41
sp|Q2K342|NDVA_RHIEC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ndvA PE=3 SV=2 321 642 5.0E-41
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 404 1317 1.0E-40
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 786 1305 1.0E-40
sp|Q6C6N0|ATM1_YARLI Iron-sulfur clusters transporter ATM1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATM1 PE=3 SV=1 395 644 2.0E-40
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 801 1308 5.0E-40
sp|Q983H5|NDVA_RHILO Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium loti (strain MAFF303099) GN=ndvA PE=3 SV=1 321 642 6.0E-40
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 907 1309 7.0E-40
sp|Q6BXD7|ATM1_DEBHA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATM1 PE=3 SV=2 965 1315 1.0E-39
sp|O07550|YHEI_BACSU Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI OS=Bacillus subtilis (strain 168) GN=yheI PE=1 SV=1 766 1314 1.0E-39
sp|P59852|LAGD_LACLL Lactococcin-G-processing and transport ATP-binding protein LagD OS=Lactococcus lactis subsp. lactis GN=lagD PE=1 SV=1 315 642 1.0E-39
sp|P57552|MDLB_BUCAI Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlB PE=3 SV=1 1058 1313 2.0E-39
sp|Q6CX96|ATM1_KLULA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATM1 PE=3 SV=1 396 656 2.0E-39
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 135 651 3.0E-39
sp|Q8G0T8|NDVA_BRUSU Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella suis biovar 1 (strain 1330) GN=ndvA PE=3 SV=1 334 642 3.0E-39
sp|Q8K984|MDLB_BUCAP Multidrug resistance-like ATP-binding protein MdlB OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlB PE=3 SV=1 1089 1308 4.0E-39
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 759 1305 5.0E-39
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 759 1305 5.0E-39
sp|Q59R09|ATM1_CANAL Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATM1 PE=3 SV=1 1061 1299 5.0E-39
sp|P40416|ATM1_YEAST Iron-sulfur clusters transporter ATM1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATM1 PE=1 SV=2 396 658 6.0E-39
sp|P0A2V1|NDVA_RHIRD Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium radiobacter GN=ndvA PE=1 SV=1 321 645 6.0E-39
sp|P0A2V0|NDVA_AGRFC Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ndvA PE=3 SV=1 321 645 6.0E-39
sp|P9WQJ9|IRTA_MYCTU Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtA PE=1 SV=1 867 1305 7.0E-39
sp|P9WQJ8|IRTA_MYCTO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtA PE=3 SV=1 867 1305 7.0E-39
sp|P63392|IRTA_MYCBO Iron import ATP-binding/permease protein IrtA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtA PE=3 SV=1 867 1305 7.0E-39
sp|P12866|STE6_YEAST Alpha-factor-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE6 PE=1 SV=1 73 643 7.0E-39
sp|Q71ED1|NDVA_AGRVI Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Agrobacterium vitis GN=ndvA PE=3 SV=1 321 651 9.0E-39
sp|Q751N2|ATM1_ASHGO Iron-sulfur clusters transporter ATM1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATM1 PE=3 SV=1 396 638 1.0E-38
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 786 1305 2.0E-38
sp|P0C529|NDVA_BRUAB Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus biovar 1 (strain 9-941) GN=ndvA PE=3 SV=1 334 642 2.0E-38
sp|Q2YQ73|NDVA_BRUA2 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella abortus (strain 2308) GN=ndvA PE=1 SV=1 334 642 2.0E-38
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 1038 1291 3.0E-38
sp|Q8YH20|NDVA_BRUME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ndvA PE=3 SV=1 334 642 3.0E-38
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 792 1309 4.0E-38
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 803 1308 5.0E-38
sp|Q1MAB5|NDVA_RHIL3 Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ndvA PE=3 SV=1 321 642 7.0E-38
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 300 645 1.0E-37
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 300 645 1.0E-37
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 300 645 1.0E-37
sp|P77265|MDLA_ECOLI Multidrug resistance-like ATP-binding protein MdlA OS=Escherichia coli (strain K12) GN=mdlA PE=3 SV=1 1048 1315 1.0E-37
sp|Q9LZB8|AB29B_ARATH ABC transporter B family member 29, chloroplastic OS=Arabidopsis thaliana GN=ABCB29 PE=2 SV=1 1061 1304 2.0E-37
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 792 1309 2.0E-37
sp|Q480N3|MSBA2_COLP3 Lipid A export ATP-binding/permease protein MsbA 2 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=msbA2 PE=3 SV=2 770 1312 2.0E-37
sp|Q6FIK3|ATM1_CANGA Iron-sulfur clusters transporter ATM1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATM1 PE=3 SV=1 368 663 3.0E-37
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 131 665 3.0E-37
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 1078 1305 4.0E-37
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 1078 1305 4.0E-37
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 1078 1305 4.0E-37
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 382 644 9.0E-37
sp|P18767|NDVA_RHIME Beta-(1-->2)glucan export ATP-binding/permease protein NdvA OS=Rhizobium meliloti (strain 1021) GN=ndvA PE=1 SV=2 334 655 2.0E-36
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 803 1308 4.0E-36
sp|P59653|COMA_STRR6 Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=comA PE=3 SV=1 109 642 5.0E-36
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 803 1308 5.0E-36
sp|P9WQJ0|Y1273_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1311 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1311 PE=3 SV=1 877 1314 6.0E-36
sp|P0A4W5|Y1304_MYCBO Uncharacterized ABC transporter ATP-binding protein Mb1304c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1304c PE=3 SV=1 877 1314 7.0E-36
sp|P9WQJ1|Y1273_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv1273c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1273c PE=1 SV=1 877 1314 7.0E-36
sp|Q9CJB8|LCNCL_LACLA Lactococcin transport/processing ATP-binding protein LcnC-like OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lcnC PE=3 SV=1 127 639 1.0E-35
sp|A1KF14|MDREP_MYCBP Multidrug efflux ATP-binding/permease protein BCG_0231 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=BCG_0231 PE=1 SV=1 311 645 2.0E-35
sp|Q8K985|MDLA_BUCAP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mdlA PE=3 SV=1 852 1317 2.0E-35
sp|Q03727|COMA_STRPN Transport/processing ATP-binding protein ComA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=comA PE=3 SV=3 109 642 2.0E-35
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 792 1305 2.0E-35
sp|Q9ZNB0|Y742_STRCO Uncharacterized ABC transporter ATP-binding protein SCO0742 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO0742 PE=3 SV=1 774 1314 3.0E-35
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 769 1281 4.0E-35
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 803 1308 4.0E-35
sp|O53645|MDREP_MYCTU Multidrug efflux ATP-binding/permease protein Rv0194 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0194 PE=1 SV=1 311 645 5.0E-35
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 801 1308 8.0E-35
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 767 1314 9.0E-35
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 1059 1312 2.0E-34
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 803 1308 2.0E-34
sp|P36497|PEDD_PEDAC Pediocin PA-1 transport/processing ATP-binding protein PedD OS=Pediococcus acidilactici GN=pedD PE=3 SV=1 773 1312 6.0E-34
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 803 1308 6.0E-34
sp|Q00564|LCNC_LACLL Lactococcin-A transport/processing ATP-binding protein LcnC OS=Lactococcus lactis subsp. lactis GN=lcnC PE=3 SV=1 127 639 9.0E-34
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 85 643 5.0E-33
sp|P9WQJ7|IRTB_MYCTU Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=irtB PE=1 SV=1 413 643 1.0E-32
sp|P9WQJ6|IRTB_MYCTO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=irtB PE=3 SV=1 413 643 1.0E-32
sp|P63394|IRTB_MYCBO Iron import ATP-binding/permease protein IrtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=irtB PE=3 SV=1 413 643 1.0E-32
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 803 1308 1.0E-32
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 309 639 1.0E-32
sp|Q10418|MESD_LEUME Mesentericin-Y105 transport/processing ATP-binding protein MesD OS=Leuconostoc mesenteroides GN=mesD PE=3 SV=1 413 639 2.0E-32
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1028 1308 2.0E-32
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 931 1307 3.0E-32
sp|Q0P9C4|PGLK_CAMJE Protein glycosylation K OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglK PE=1 SV=1 392 622 1.0E-31
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1053 1309 1.0E-31
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 768 1279 3.0E-31
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 124 622 5.0E-31
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 1061 1306 7.0E-31
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 1060 1279 1.0E-30
sp|P57551|MDLA_BUCAI Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mdlA PE=3 SV=1 903 1317 3.0E-30
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 121 640 3.0E-30
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 121 640 3.0E-30
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 1071 1308 3.0E-30
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1079 1292 4.0E-30
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1028 1308 4.0E-30
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 394 641 5.0E-30
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1038 1312 5.0E-30
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 798 1308 7.0E-30
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 801 1292 8.0E-30
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1038 1312 1.0E-29
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 798 1309 1.0E-29
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 394 643 1.0E-29
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1038 1312 2.0E-29
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1038 1312 3.0E-29
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 381 643 3.0E-29
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 1018 1308 4.0E-29
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 395 622 5.0E-29
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 121 640 6.0E-29
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 798 1308 7.0E-29
sp|P71355|Y663_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_0663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0663 PE=3 SV=1 365 643 1.0E-28
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 394 643 1.0E-28
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1073 1319 2.0E-28
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1073 1319 2.0E-28
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 82 640 2.0E-28
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1073 1319 2.0E-28
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 378 643 2.0E-28
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 146 644 2.0E-28
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 394 643 2.0E-28
sp|P22520|CVAB_ECOLX Colicin V secretion/processing ATP-binding protein CvaB OS=Escherichia coli GN=cvaB PE=3 SV=1 401 613 3.0E-28
sp|Q57538|Y664_HAEIN Probable ABC transporter ATP-binding protein HI_0664 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0664 PE=1 SV=1 397 618 3.0E-28
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 59 642 3.0E-28
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 144 635 3.0E-28
sp|P53706|HST6_CANAW Alpha-factor-transporting ATPase OS=Candida albicans (strain WO-1) GN=HST6 PE=3 SV=1 397 642 3.0E-28
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 798 1308 3.0E-28
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 1055 1313 3.0E-28
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 1028 1292 4.0E-28
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 767 1303 5.0E-28
sp|Q1QXH6|PSTB1_CHRSD Phosphate import ATP-binding protein PstB 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pstB1 PE=3 SV=1 1063 1291 6.0E-28
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 803 1297 6.0E-28
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 394 643 8.0E-28
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 146 622 8.0E-28
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 1051 1319 8.0E-28
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 332 636 1.0E-27
sp|Q89A97|MDLA_BUCBP Multidrug resistance-like ATP-binding protein MdlA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mdlA PE=3 SV=1 135 632 1.0E-27
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 131 644 1.0E-27
sp|Q38YC1|PSTB2_LACSS Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pstB2 PE=3 SV=1 1076 1291 1.0E-27
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 394 641 2.0E-27
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 146 644 2.0E-27
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 394 643 2.0E-27
sp|Q9EXN5|MCHF_ECOLX Probable microcin-H47 secretion/processing ATP-binding protein MchF OS=Escherichia coli GN=mchF PE=3 SV=1 414 613 3.0E-27
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 1078 1304 3.0E-27
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 395 641 4.0E-27
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 394 654 4.0E-27
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 1055 1308 4.0E-27
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1079 1311 5.0E-27
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 905 1313 6.0E-27
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 413 642 6.0E-27
sp|Q88YK7|PSTB2_LACPL Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pstB2 PE=3 SV=1 1076 1293 6.0E-27
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1079 1311 6.0E-27
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 394 643 6.0E-27
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 309 622 7.0E-27
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 1051 1312 1.0E-26
sp|Q3SVB5|PSTB_NITWN Phosphate import ATP-binding protein PstB OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pstB PE=3 SV=1 1056 1298 1.0E-26
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 1037 1299 1.0E-26
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 397 652 2.0E-26
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 1045 1308 2.0E-26
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 903 1298 2.0E-26
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1079 1312 2.0E-26
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 394 641 2.0E-26
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 362 630 2.0E-26
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 79 632 2.0E-26
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 127 622 3.0E-26
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 375 640 3.0E-26
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 996 1313 3.0E-26
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 395 640 3.0E-26
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 394 622 3.0E-26
sp|P45081|CYDC_HAEIN ATP-binding/permease protein CydC OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydC PE=3 SV=1 358 641 4.0E-26
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 801 1313 4.0E-26
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 395 645 5.0E-26
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1036 1303 6.0E-26
sp|Q52402|AARD_PROST Transport ATP-binding protein AarD OS=Providencia stuartii GN=aarD PE=3 SV=1 418 640 8.0E-26
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 1076 1298 8.0E-26
sp|P94367|CYDD_BACSU ATP-binding/permease protein CydD OS=Bacillus subtilis (strain 168) GN=cydD PE=3 SV=1 1078 1306 8.0E-26
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 394 622 8.0E-26
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 394 630 1.0E-25
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1056 1311 1.0E-25
sp|Q834B4|PSTB1_ENTFA Phosphate import ATP-binding protein PstB 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pstB1 PE=3 SV=1 1076 1292 1.0E-25
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 1098 1316 1.0E-25
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 393 649 1.0E-25
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 137 641 1.0E-25
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 1081 1315 2.0E-25
sp|P45082|CYDD_HAEIN ATP-binding/permease protein CydD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cydD PE=3 SV=1 418 645 2.0E-25
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 1076 1298 2.0E-25
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 1069 1297 2.0E-25
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 137 641 2.0E-25
sp|Q1IGN4|METN1_PSEE4 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas entomophila (strain L48) GN=metN1 PE=3 SV=1 384 624 2.0E-25
sp|P16875|MDR1_ENTHI Multidrug resistance protein 1 (Fragment) OS=Entamoeba histolytica GN=MDR1 PE=3 SV=1 1099 1222 2.0E-25
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 415 622 2.0E-25
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 415 622 2.0E-25
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 137 641 2.0E-25
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1071 1311 2.0E-25
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1042 1302 2.0E-25
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 52 642 2.0E-25
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 395 645 2.0E-25
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1056 1299 2.0E-25
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 137 641 3.0E-25
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 1080 1298 4.0E-25
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 1069 1297 5.0E-25
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 1078 1298 5.0E-25
sp|Q7A470|ECFA1_STAAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain N315) GN=ecfA1 PE=3 SV=1 397 639 5.0E-25
sp|Q99S47|ECFA1_STAAM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA1 PE=3 SV=1 397 639 5.0E-25
sp|Q0D9V6|STAR1_ORYSJ Protein STAR1 OS=Oryza sativa subsp. japonica GN=STAR1 PE=1 SV=1 397 622 5.0E-25
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 1062 1315 6.0E-25
sp|Q48HD9|PSTB1_PSE14 Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pstB1 PE=3 SV=1 386 624 6.0E-25
sp|P63372|PSTB3_STRA5 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB3 PE=3 SV=1 1080 1300 7.0E-25
sp|P63371|PSTB3_STRA3 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB3 PE=3 SV=1 1080 1300 7.0E-25
sp|Q8E9I8|PSTB2_SHEON Phosphate import ATP-binding protein PstB 2 OS=Shewanella oneidensis (strain MR-1) GN=pstB2 PE=3 SV=1 1080 1298 7.0E-25
sp|Q46BM0|PSTB_METBF Phosphate import ATP-binding protein PstB OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pstB PE=3 SV=1 1061 1292 7.0E-25
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 394 639 7.0E-25
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 394 636 7.0E-25
sp|Q13CR0|PSTB_RHOPS Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain BisB5) GN=pstB PE=3 SV=1 1056 1298 8.0E-25
sp|Q4ZRT7|PSTB1_PSEU2 Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pstB1 PE=3 SV=1 1057 1301 8.0E-25
sp|Q880A6|PSTB1_PSESM Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pstB1 PE=3 SV=1 1057 1301 8.0E-25
sp|Q3JYY5|PSTB3_STRA1 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB3 PE=3 SV=1 1080 1291 8.0E-25
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 1046 1299 1.0E-24
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 1018 1299 1.0E-24
sp|Q8PAG0|PSTB_XANCP Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pstB PE=3 SV=1 1076 1296 1.0E-24
sp|Q4UT63|PSTB_XANC8 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pstB PE=3 SV=1 1076 1296 1.0E-24
sp|Q48HD9|PSTB1_PSE14 Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pstB1 PE=3 SV=1 1057 1301 1.0E-24
sp|Q4ZRT7|PSTB1_PSEU2 Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pstB1 PE=3 SV=1 386 624 1.0E-24
sp|Q880A6|PSTB1_PSESM Phosphate import ATP-binding protein PstB 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pstB1 PE=3 SV=1 386 624 1.0E-24
sp|Q8Y4E9|PSTB2_LISMO Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB2 PE=3 SV=1 1080 1298 1.0E-24
sp|Q927Z7|PSTB2_LISIN Phosphate import ATP-binding protein PstB 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB2 PE=3 SV=1 1080 1298 1.0E-24
sp|Q71WT2|PSTB2_LISMF Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB2 PE=3 SV=1 1080 1298 1.0E-24
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 1083 1293 1.0E-24
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1079 1312 1.0E-24
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 395 641 1.0E-24
sp|Q1Q8K4|PSTB_PSYCK Phosphate import ATP-binding protein PstB OS=Psychrobacter cryohalolentis (strain K5) GN=pstB PE=3 SV=2 1078 1298 1.0E-24
sp|Q7NZI7|PSTB_CHRVO Phosphate import ATP-binding protein PstB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pstB PE=3 SV=1 390 624 2.0E-24
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 393 649 2.0E-24
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 395 675 2.0E-24
sp|Q2J220|PSTB_RHOP2 Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain HaA2) GN=pstB PE=3 SV=1 1056 1298 2.0E-24
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 395 641 2.0E-24
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 1057 1292 2.0E-24
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 1057 1292 2.0E-24
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 1057 1292 2.0E-24
sp|Q4FQD1|PSTB_PSYA2 Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2 1078 1298 2.0E-24
sp|Q4FQD1|PSTB_PSYA2 Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2 397 629 2.0E-24
sp|Q9PPV1|ECFA1_UREPA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ecfA1 PE=3 SV=1 397 643 2.0E-24
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 1078 1298 2.0E-24
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 1080 1301 2.0E-24
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 414 640 2.0E-24
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1080 1298 3.0E-24
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 397 652 3.0E-24
sp|Q2YYM4|ECFA1_STAAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA1 PE=3 SV=2 397 633 3.0E-24
sp|Q1Q8K4|PSTB_PSYCK Phosphate import ATP-binding protein PstB OS=Psychrobacter cryohalolentis (strain K5) GN=pstB PE=3 SV=2 397 629 4.0E-24
sp|Q180A5|PSTB_PEPD6 Phosphate import ATP-binding protein PstB OS=Peptoclostridium difficile (strain 630) GN=pstB PE=3 SV=1 1078 1292 4.0E-24
sp|Q6GEL3|ECFA1_STAAR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1 397 633 4.0E-24
sp|Q9HS13|PSTB1_HALSA Phosphate import ATP-binding protein PstB 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pstB1 PE=3 SV=1 1077 1298 5.0E-24
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 1056 1302 5.0E-24
sp|Q1QQH1|PSTB_NITHX Phosphate import ATP-binding protein PstB OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pstB PE=3 SV=1 1056 1298 5.0E-24
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 415 622 5.0E-24
sp|Q3ZWN4|PSTB_DEHMC Phosphate import ATP-binding protein PstB OS=Dehalococcoides mccartyi (strain CBDB1) GN=pstB PE=3 SV=1 1061 1301 5.0E-24
sp|Q20WP4|PSTB_RHOPB Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain BisB18) GN=pstB PE=3 SV=1 394 629 5.0E-24
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 1079 1292 5.0E-24
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 395 622 5.0E-24
sp|Q5HVF4|PSTB_CAMJR Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni (strain RM1221) GN=pstB PE=3 SV=1 415 632 6.0E-24
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 415 622 6.0E-24
sp|Q6G0L7|PSTB_BARQU Phosphate import ATP-binding protein PstB OS=Bartonella quintana (strain Toulouse) GN=pstB PE=3 SV=1 397 604 6.0E-24
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 395 646 8.0E-24
sp|Q2SNX4|PSTB_HAHCH Phosphate import ATP-binding protein PstB OS=Hahella chejuensis (strain KCTC 2396) GN=pstB PE=3 SV=1 415 629 8.0E-24
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 1079 1308 9.0E-24
sp|Q2J220|PSTB_RHOP2 Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain HaA2) GN=pstB PE=3 SV=1 397 629 9.0E-24
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 128 641 9.0E-24
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 332 644 9.0E-24
sp|Q5FM18|PSTB1_LACAC Phosphate import ATP-binding protein PstB 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pstB1 PE=3 SV=1 1085 1298 9.0E-24
sp|Q3ZA58|PSTB_DEHM1 Phosphate import ATP-binding protein PstB OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pstB PE=3 SV=1 1061 1301 9.0E-24
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 253 630 9.0E-24
sp|Q9PHQ1|PSTB_CAMJE Phosphate import ATP-binding protein PstB OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pstB PE=3 SV=1 415 632 1.0E-23
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 397 624 1.0E-23
sp|Q3SJQ8|PSTB_THIDA Phosphate import ATP-binding protein PstB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pstB PE=3 SV=1 1055 1303 1.0E-23
sp|Q5FM17|PSTB2_LACAC Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pstB2 PE=3 SV=1 1077 1298 1.0E-23
sp|Q4KK46|METN2_PSEF5 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN2 PE=3 SV=1 394 624 1.0E-23
sp|Q4QK92|PSTB_HAEI8 Phosphate import ATP-binding protein PstB OS=Haemophilus influenzae (strain 86-028NP) GN=pstB PE=3 SV=1 397 648 1.0E-23
sp|Q58418|PSTB_METJA Phosphate import ATP-binding protein PstB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pstB PE=3 SV=1 1078 1298 1.0E-23
sp|Q5H002|PSTB_XANOR Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pstB PE=3 SV=2 415 622 1.0E-23
sp|Q2P2Y5|PSTB_XANOM Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pstB PE=3 SV=1 415 622 1.0E-23
sp|Q88RB3|METN2_PSEPK Methionine import ATP-binding protein MetN 2 OS=Pseudomonas putida (strain KT2440) GN=metN2 PE=3 SV=1 389 624 1.0E-23
sp|Q5HDY6|ECFA1_STAAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1 397 639 1.0E-23
sp|Q2FW34|ECFA1_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1 397 639 1.0E-23
sp|Q2FER7|ECFA1_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1 397 639 1.0E-23
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 414 630 1.0E-23
sp|Q6N0I5|PSTB_RHOPA Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pstB PE=3 SV=1 1056 1298 1.0E-23
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 414 833 1.0E-23
sp|P16875|MDR1_ENTHI Multidrug resistance protein 1 (Fragment) OS=Entamoeba histolytica GN=MDR1 PE=3 SV=1 434 553 2.0E-23
sp|Q8E9I8|PSTB2_SHEON Phosphate import ATP-binding protein PstB 2 OS=Shewanella oneidensis (strain MR-1) GN=pstB2 PE=3 SV=1 415 632 2.0E-23
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 394 640 2.0E-23
sp|Q8PM59|PSTB_XANAC Phosphate import ATP-binding protein PstB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pstB PE=3 SV=1 1076 1296 2.0E-23
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 394 640 2.0E-23
sp|Q5H002|PSTB_XANOR Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=pstB PE=3 SV=2 1076 1296 2.0E-23
sp|Q2P2Y5|PSTB_XANOM Phosphate import ATP-binding protein PstB OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=pstB PE=3 SV=1 1076 1296 2.0E-23
sp|Q47A37|PSTB_DECAR Phosphate import ATP-binding protein PstB OS=Dechloromonas aromatica (strain RCB) GN=pstB PE=3 SV=1 1078 1301 2.0E-23
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 411 629 2.0E-23
sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein PstB OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pstB PE=3 SV=1 1061 1301 2.0E-23
sp|Q8ZX91|PSTB_PYRAE Phosphate import ATP-binding protein PstB OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pstB PE=3 SV=1 1078 1298 2.0E-23
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 400 624 2.0E-23
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 1068 1300 2.0E-23
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 394 641 2.0E-23
sp|P47260|Y014_MYCGE Putative ABC transporter ATP-binding protein MG014 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG014 PE=3 SV=1 1080 1312 3.0E-23
sp|P29018|CYDD_ECOLI ATP-binding/permease protein CydD OS=Escherichia coli (strain K12) GN=cydD PE=1 SV=3 406 640 3.0E-23
sp|Q9C9W0|AB17I_ARATH ABC transporter I family member 17 OS=Arabidopsis thaliana GN=ABCI17 PE=2 SV=1 414 622 3.0E-23
sp|Q3BV68|PSTB_XANC5 Phosphate import ATP-binding protein PstB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=pstB PE=3 SV=2 1076 1296 3.0E-23
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 394 640 3.0E-23
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 394 641 3.0E-23
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 394 640 3.0E-23
sp|Q8NVB5|ECFA1_STAAW Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MW2) GN=ecfA1 PE=3 SV=1 397 633 3.0E-23
sp|Q6G799|ECFA1_STAAS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA1 PE=3 SV=1 397 633 3.0E-23
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 394 640 4.0E-23
sp|Q20WP4|PSTB_RHOPB Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain BisB18) GN=pstB PE=3 SV=1 1077 1298 4.0E-23
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 394 640 4.0E-23
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 395 646 4.0E-23
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 395 641 4.0E-23
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 395 641 4.0E-23
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 394 640 4.0E-23
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 352 671 5.0E-23
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 395 641 5.0E-23
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 26 638 8.0E-23
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 395 653 9.0E-23
sp|P94366|CYDC_BACSU ATP-binding/permease protein CydC OS=Bacillus subtilis (strain 168) GN=cydC PE=3 SV=1 433 643 9.0E-23
sp|Q13CR0|PSTB_RHOPS Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain BisB5) GN=pstB PE=3 SV=1 415 629 1.0E-22
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 138 653 1.0E-22
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 414 640 1.0E-22
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 381 662 2.0E-22
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 415 667 2.0E-22
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 257 660 3.0E-22
sp|Q8ZX91|PSTB_PYRAE Phosphate import ATP-binding protein PstB OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pstB PE=3 SV=1 411 629 3.0E-22
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 395 641 3.0E-22
sp|P33116|SPAT_BACIU Subtilin transport ATP-binding protein SpaT OS=Bacillus subtilis GN=spaT PE=3 SV=1 186 656 4.0E-22
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 395 655 4.0E-22
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 381 641 4.0E-22
sp|Q5FM17|PSTB2_LACAC Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pstB2 PE=3 SV=1 411 629 4.0E-22
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 373 659 4.0E-22
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 102 641 4.0E-22
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 381 665 5.0E-22
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 395 658 6.0E-22
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 420 631 6.0E-22
sp|Q1QXH6|PSTB1_CHRSD Phosphate import ATP-binding protein PstB 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pstB1 PE=3 SV=1 397 629 6.0E-22
sp|Q1QQH1|PSTB_NITHX Phosphate import ATP-binding protein PstB OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=pstB PE=3 SV=1 415 629 7.0E-22
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 390 694 8.0E-22
sp|Q71WT2|PSTB2_LISMF Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB2 PE=3 SV=1 411 627 9.0E-22
sp|Q88YK7|PSTB2_LACPL Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pstB2 PE=3 SV=1 415 629 1.0E-21
sp|Q8Y4E9|PSTB2_LISMO Phosphate import ATP-binding protein PstB 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB2 PE=3 SV=1 411 627 1.0E-21
sp|Q927Z7|PSTB2_LISIN Phosphate import ATP-binding protein PstB 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB2 PE=3 SV=1 411 627 1.0E-21
sp|Q9PPV1|ECFA1_UREPA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=ecfA1 PE=3 SV=1 1057 1300 1.0E-21
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 395 622 1.0E-21
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 413 664 1.0E-21
sp|Q3SVB5|PSTB_NITWN Phosphate import ATP-binding protein PstB OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=pstB PE=3 SV=1 415 629 2.0E-21
sp|P75095|Y018_MYCPN Putative ABC transporter ATP-binding protein MG014 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_018 PE=3 SV=1 1056 1312 2.0E-21
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 415 641 3.0E-21
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 352 660 3.0E-21
sp|Q58418|PSTB_METJA Phosphate import ATP-binding protein PstB OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pstB PE=3 SV=1 415 629 3.0E-21
sp|Q38YC1|PSTB2_LACSS Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pstB2 PE=3 SV=1 415 629 3.0E-21
sp|Q03203|NIST_LACLL Nisin transport ATP-binding protein NisT OS=Lactococcus lactis subsp. lactis GN=nisT PE=3 SV=1 334 652 4.0E-21
sp|Q2SNX4|PSTB_HAHCH Phosphate import ATP-binding protein PstB OS=Hahella chejuensis (strain KCTC 2396) GN=pstB PE=3 SV=1 1078 1298 4.0E-21
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 413 662 4.0E-21
sp|Q9HS13|PSTB1_HALSA Phosphate import ATP-binding protein PstB 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pstB1 PE=3 SV=1 415 632 7.0E-21
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 394 632 8.0E-21
sp|Q6N0I5|PSTB_RHOPA Phosphate import ATP-binding protein PstB OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=pstB PE=3 SV=1 415 629 9.0E-21
sp|Q72D46|PSTB_DESVH Phosphate import ATP-binding protein PstB OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=pstB PE=3 SV=1 1065 1301 9.0E-21
sp|Q180A5|PSTB_PEPD6 Phosphate import ATP-binding protein PstB OS=Peptoclostridium difficile (strain 630) GN=pstB PE=3 SV=1 411 622 1.0E-20
sp|Q3ZWN4|PSTB_DEHMC Phosphate import ATP-binding protein PstB OS=Dehalococcoides mccartyi (strain CBDB1) GN=pstB PE=3 SV=1 397 624 1.0E-20
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 1033 1316 1.0E-20
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 1079 1309 1.0E-20
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 1079 1309 1.0E-20
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 414 646 1.0E-20
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 415 657 1.0E-20
sp|P0CE69|YK104_YEAST Putative uncharacterized protein YKR104W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKR104W PE=5 SV=1 1056 1313 2.0E-20
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 411 629 2.0E-20
sp|Q6FAN3|METN1_ACIAD Methionine import ATP-binding protein MetN 1 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN1 PE=3 SV=1 1062 1293 2.0E-20
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 409 667 2.0E-20
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 1079 1309 2.0E-20
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 1003 1317 3.0E-20
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 415 641 3.0E-20
sp|Q2S081|PSTB_SALRD Phosphate import ATP-binding protein PstB OS=Salinibacter ruber (strain DSM 13855 / M31) GN=pstB PE=3 SV=1 393 629 3.0E-20
sp|Q3SJQ8|PSTB_THIDA Phosphate import ATP-binding protein PstB OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pstB PE=3 SV=1 397 622 4.0E-20
sp|Q88RB3|METN2_PSEPK Methionine import ATP-binding protein MetN 2 OS=Pseudomonas putida (strain KT2440) GN=metN2 PE=3 SV=1 1051 1293 7.0E-20
sp|Q3ZA58|PSTB_DEHM1 Phosphate import ATP-binding protein PstB OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pstB PE=3 SV=1 397 624 8.0E-20
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 418 603 1.0E-19
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 1009 1309 1.0E-19
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 413 670 1.0E-19
sp|Q47A37|PSTB_DECAR Phosphate import ATP-binding protein PstB OS=Dechloromonas aromatica (strain RCB) GN=pstB PE=3 SV=1 415 644 1.0E-19
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 1009 1309 2.0E-19
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 305 644 2.0E-19
sp|Q0SVB6|PSTB_CLOPS Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain SM101 / Type A) GN=pstB PE=3 SV=1 390 622 2.0E-19
sp|Q8XMP8|PSTB_CLOPE Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain 13 / Type A) GN=pstB PE=3 SV=1 390 622 2.0E-19
sp|Q0TTG6|PSTB_CLOP1 Phosphate import ATP-binding protein PstB OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pstB PE=3 SV=1 390 622 2.0E-19
sp|Q6G0L7|PSTB_BARQU Phosphate import ATP-binding protein PstB OS=Bartonella quintana (strain Toulouse) GN=pstB PE=3 SV=1 1080 1293 2.0E-19
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 1003 1317 2.0E-19
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 1012 1294 2.0E-19
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 1080 1319 2.0E-19
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 414 631 2.0E-19
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 418 659 3.0E-19
sp|Q1IGN4|METN1_PSEE4 Methionine import ATP-binding protein MetN 1 OS=Pseudomonas entomophila (strain L48) GN=metN1 PE=3 SV=1 1056 1293 3.0E-19
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 404 693 3.0E-19
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 414 681 4.0E-19
sp|Q83GE8|PSTB_TROWT Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain Twist) GN=pstB PE=3 SV=2 418 603 4.0E-19
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 1009 1309 5.0E-19
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 1012 1294 6.0E-19
sp|Q9X2W0|MCJD_ECOLX Microcin-J25 export ATP-binding/permease protein McjD OS=Escherichia coli GN=mcjD PE=1 SV=1 101 630 6.0E-19
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 1009 1309 8.0E-19
sp|P63372|PSTB3_STRA5 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB3 PE=3 SV=1 415 629 9.0E-19
sp|P63371|PSTB3_STRA3 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB3 PE=3 SV=1 415 629 9.0E-19
sp|Q3JYY5|PSTB3_STRA1 Phosphate import ATP-binding protein PstB 3 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB3 PE=3 SV=1 415 629 1.0E-18
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 1052 1309 1.0E-18
sp|Q03024|APRD_PSEAE Alkaline protease secretion ATP-binding protein AprD OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aprD PE=3 SV=1 1056 1300 2.0E-18
sp|Q4QK92|PSTB_HAEI8 Phosphate import ATP-binding protein PstB OS=Haemophilus influenzae (strain 86-028NP) GN=pstB PE=3 SV=1 1060 1301 2.0E-18
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 415 659 2.0E-18
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 414 679 2.0E-18
sp|Q834B4|PSTB1_ENTFA Phosphate import ATP-binding protein PstB 1 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pstB1 PE=3 SV=1 415 622 3.0E-18
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 1080 1309 3.0E-18
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 410 676 3.0E-18
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 383 641 4.0E-18
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 380 642 4.0E-18
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 1080 1294 4.0E-18
sp|Q4KK46|METN2_PSEF5 Methionine import ATP-binding protein MetN 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metN2 PE=3 SV=1 1078 1293 8.0E-18
sp|Q5FM18|PSTB1_LACAC Phosphate import ATP-binding protein PstB 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pstB1 PE=3 SV=1 408 622 9.0E-18
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1036 1305 1.0E-17
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 1057 1299 1.0E-17
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 478 920 2.0E-17
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 988 1299 2.0E-17
sp|Q7ANN4|PRSD_RHIME Type I secretion system ATP-binding protein PrsD OS=Rhizobium meliloti (strain 1021) GN=prsD PE=1 SV=2 1056 1301 3.0E-17
sp|Q46BM0|PSTB_METBF Phosphate import ATP-binding protein PstB OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pstB PE=3 SV=1 415 632 5.0E-17
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 1051 1300 7.0E-17
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 1077 1305 8.0E-17
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 1080 1294 9.0E-17
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 1077 1305 9.0E-17
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 414 644 1.0E-16
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 1033 1299 1.0E-16
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 1074 1305 1.0E-16
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 1077 1305 1.0E-16
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 1080 1303 2.0E-16
sp|Q8G7F4|PSTB_BIFLO Phosphate import ATP-binding protein PstB OS=Bifidobacterium longum (strain NCC 2705) GN=pstB PE=3 SV=1 418 604 2.0E-16
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 766 1298 2.0E-16
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 415 625 7.0E-16
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 415 625 9.0E-16
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 1080 1305 1.0E-15
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 1045 1299 1.0E-15
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 415 625 1.0E-15
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 397 662 2.0E-15
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 397 662 2.0E-15
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1080 1303 2.0E-15
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 1062 1301 3.0E-15
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 415 625 3.0E-15
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 1080 1309 3.0E-15
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 415 666 4.0E-15
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 1031 1310 7.0E-15
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 1079 1310 8.0E-15
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1048 1293 1.0E-14
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 1080 1309 1.0E-14
sp|Q7A470|ECFA1_STAAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain N315) GN=ecfA1 PE=3 SV=1 1057 1304 2.0E-14
sp|Q99S47|ECFA1_STAAM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA1 PE=3 SV=1 1057 1304 2.0E-14
sp|Q6GEL3|ECFA1_STAAR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1 1057 1298 2.0E-14
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 1079 1301 2.0E-14
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 1080 1301 3.0E-14
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 1080 1317 3.0E-14
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 1080 1294 4.0E-14
sp|Q5HDY6|ECFA1_STAAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1 1057 1298 4.0E-14
sp|Q2FW34|ECFA1_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1 1057 1298 4.0E-14
sp|Q2FER7|ECFA1_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1 1057 1298 4.0E-14
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 478 643 4.0E-14
sp|Q2YYM4|ECFA1_STAAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA1 PE=3 SV=2 1057 1298 6.0E-14
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 418 865 6.0E-14
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1080 1310 6.0E-14
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 1055 1299 7.0E-14
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 1080 1298 9.0E-14
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 1080 1298 1.0E-13
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1080 1302 1.0E-13
sp|Q8NVB5|ECFA1_STAAW Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MW2) GN=ecfA1 PE=3 SV=1 1057 1298 1.0E-13
sp|Q6G799|ECFA1_STAAS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA1 PE=3 SV=1 1057 1298 1.0E-13
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 419 630 2.0E-13
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 1080 1299 2.0E-13
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 1112 1299 2.0E-13
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 480 644 3.0E-13
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 1112 1299 3.0E-13
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 1112 1299 4.0E-13
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 478 659 6.0E-13
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 1052 1313 7.0E-13
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 201 649 1.0E-12
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 413 629 1.0E-12
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 413 629 1.0E-12
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 1080 1289 2.0E-12
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 415 618 3.0E-12
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 869 1299 7.0E-12
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 1062 1301 2.0E-11
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 869 1299 2.0E-11
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 1080 1305 3.0E-11
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 418 680 4.0E-11
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 1145 1316 4.0E-11
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 1080 1318 6.0E-11
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 1045 1299 2.0E-10
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 1045 1299 2.0E-10
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 415 577 4.0E-10
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 1011 1299 5.0E-10
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 824 1305 1.0E-09
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 1080 1262 4.0E-09
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 450 679 5.0E-09
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 1141 1299 8.0E-09
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 866 1298 8.0E-08
sp|Q8T9W1|TAGD_DICDI Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum GN=tagD PE=3 SV=1 769 1037 1.0E-07
sp|Q23868|TAGC_DICDI Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum GN=tagC PE=2 SV=2 769 1026 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 121 143 22
3 194 216 22
4 220 238 18
5 297 319 22
6 724 746 22
7 767 789 22
8 840 862 22
9 869 891 22
10 952 974 22
11 987 1009 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2550
MATGKKQQTSLVAAPRDGSASRSGGSTDRGSSGGGGKDGNGGGDEGGEQGSSFKYLLRVFAYNDAKGWLMNAVAL
VCIIASGTALPLMDLVFGKFVNTFNDFATGKLSPAGYRAEVSRSSLYFVYIFIGKFVLTYIWTVLINVTAIRTTK
KLRVDFVRQMLRQEVSFFDAPSASVSGQITTNGNLVNNGISEKLGLTVQAMASFVTAFVVAFAVQWKLTLIVLAI
VPVNVAVTVACVVRDTMLEYRMFDIYGESGSLAQEAFASIRNAHAFWAFPSLVARFGAILDRAAHVGDKKSLVYA
ILFPTEFFCVIAGYALAFWQGMRMYASGEIQNPGTVVTVIFAILVAAQALTQIAPQTVAISKATAAAQDLFRIID
RQSATDSLSQDGLRISSFRGDIRLRGVRFAYPSRPDVPVLHGLDLDIPADKTTALVGSSGSGKSTIFGILERWYP
FSAGTVTLDGHALGDLNLQWLRTNIRLVQQEPTLFSGTIFQNVVDGLTGTDMVQLADEEKQRLVIEACKASYSHD
FIQDLPNGYETYIGERDASLSGGQKQRIVIARSIISDPKVLLLDEATSALDPNAEKIVQAALNNVAKGRTMVVIA
HRLSTIRDADNIVVMSKGETIESGTHQQLIDHGGAYARLVKAQDLGRGGDNDVEEEDDDDDDEEGDGEKQKGAAA
ANDLEAALTRASTVAASLGGGGASWAGPDRSRYGLLHGLYLILREQKPLWWPMAVTLACCAVGGGTYPALAILFS
KTMDAFQTVNVSRTNFFALMFFVVALANFVAYAIVGWFANVLAQSVMKFYRREIFNNTLRQDMIFFDHGDNSTGA
LVSRLAAEPTSLQELLSVNVALIVINVVNLLASSVLAIAYGWKLGLVLSFGALPVLVGAGYLRIRLEFKFENDTA
ARFARSSGVAAEAVMGIRTISSLALERAVIERYEEQLRGIAARAMGSLGWKMLFYALSQSVSFLAMALGFWYGGR
LVSTGEYDNGQFYVIFMAVVYSAEAAAMLFQYTTSITKARTAINYIFDLRRHVELVDDDEDNEDENDGGDDGTDG
EKSGPPDKGTEVRLEGVEFAYPLRPRHKVLRGIDLDMASGKMVALVGASGCGKSTVISLLERFYDPTAGRVSADG
RDVRSLGRRRYRRDVALVQQEPVLYQGSIRENVVLGLGGRRASPGRAGDADADADAATEVACRAANVWDFIASLP
QGLDTPCGAQGLSLSGGQRQRIAIARALMRRPRLLLLDEATSALDTESEAVVKRALDRAAAGRTTVAVAHRLSTV
RDADLIAVFARGSIVELGTHDELVARRGLYYDMVLSQSLDREAA*
Coding >Hirsu2|2550
ATGGCGACGGGCAAGAAGCAGCAGACCAGCCTTGTGGCCGCCCCGCGGGACGGGAGCGCCTCGCGATCGGGCGGT
TCGACGGACAGGGGCAGTAGCGGCGGCGGCGGCAAGGATGGGAACGGCGGCGGCGACGAGGGAGGCGAGCAAGGC
TCGAGCTTCAAGTACCTGCTGCGCGTCTTCGCCTACAACGACGCCAAGGGCTGGCTCATGAACGCCGTGGCCCTC
GTCTGCATCATCGCCTCCGGCACCGCCCTGCCGCTGATGGACCTCGTCTTCGGCAAGTTCGTCAACACCTTCAAC
GACTTCGCCACAGGCAAGCTGTCGCCCGCCGGCTACCGGGCCGAGGTCTCTCGCTCCTCCTTGTACTTCGTCTAC
ATCTTCATCGGAAAGTTCGTGTTGACGTACATCTGGACGGTCCTCATCAACGTCACGGCCATCCGCACGACCAAG
AAGCTGCGCGTCGACTTCGTCCGCCAGATGCTCCGCCAGGAAGTCTCCTTCTTCGATGCGCCCTCGGCCTCCGTC
TCGGGCCAGATCACGACCAACGGGAACCTGGTCAACAACGGCATCTCGGAGAAGTTGGGCCTGACGGTCCAGGCC
ATGGCCAGCTTCGTCACCGCCTTCGTCGTCGCCTTCGCCGTTCAGTGGAAGCTGACGCTCATCGTCCTGGCCATC
GTCCCCGTCAACGTGGCCGTCACCGTCGCCTGCGTCGTCCGCGACACGATGCTCGAGTACCGCATGTTCGACATC
TACGGCGAGAGCGGCAGCCTGGCCCAGGAGGCCTTTGCCTCCATCCGCAACGCCCACGCCTTCTGGGCCTTCCCC
AGCCTCGTCGCCCGCTTCGGCGCCATCCTCGACCGCGCCGCCCACGTCGGCGACAAGAAGTCGCTCGTCTACGCC
ATCCTCTTCCCCACCGAGTTCTTCTGCGTCATCGCCGGCTACGCCCTGGCCTTTTGGCAGGGCATGCGCATGTAC
GCCTCGGGCGAGATCCAGAACCCAGGCACCGTCGTGACCGTCATCTTCGCCATCCTGGTCGCCGCCCAGGCCCTC
ACCCAGATCGCGCCCCAGACCGTCGCCATCTCCAAGGCCACCGCCGCCGCCCAGGACCTGTTCCGCATCATCGAC
CGCCAGTCCGCCACCGACTCGCTCTCCCAAGACGGCCTCCGCATCTCGTCCTTCCGGGGCGATATCCGGCTGCGC
GGCGTGCGCTTCGCCTATCCCTCCCGACCCGACGTCCCTGTCCTCCACGGCCTCGACCTCGACATCCCGGCTGAC
AAAACGACAGCCTTGGTCGGCTCCAGTGGCTCCGGCAAGAGCACAATCTTCGGCATTCTCGAACGCTGGTACCCC
TTCTCGGCCGGCACTGTCACCCTCGATGGACATGCCCTCGGCGACCTCAACCTGCAGTGGCTCCGCACCAACATC
AGGCTGGTCCAGCAGGAGCCGACTCTGTTCAGCGGCACCATCTTCCAGAACGTCGTCGACGGCCTGACCGGGACC
GACATGGTCCAACTTGCCGACGAGGAGAAGCAAAGGCTCGTGATAGAGGCTTGCAAGGCGTCCTATTCCCATGAC
TTCATTCAAGACTTGCCCAACGGCTACGAGACGTACATTGGTGAACGAGATGCCTCTCTGTCAGGCGGACAGAAG
CAGCGCATCGTCATTGCCCGCAGCATCATTTCCGACCCCAAGGTCCTGCTGCTGGATGAGGCCACCAGCGCGCTC
GACCCTAACGCCGAAAAGATTGTCCAGGCGGCCCTCAACAACGTCGCCAAGGGCCGAACTATGGTTGTCATAGCC
CACCGGCTGTCGACGATCCGCGACGCCGATAATATAGTCGTCATGTCCAAGGGCGAGACCATAGAGAGCGGTACG
CATCAACAGCTGATTGACCACGGGGGCGCATACGCCCGGCTTGTCAAGGCGCAGGATCTGGGACGCGGTGGGGAC
AATGACGTTGAGGAAGAGGACGACGACGACGACGACGAGGAGGGCGATGGAGAGAAGCAGAAGGGCGCCGCGGCC
GCCAACGACCTCGAAGCCGCCCTGACCCGGGCCTCGACGGTGGCGGCATCCCTCGGCGGCGGCGGAGCATCCTGG
GCCGGGCCAGACCGCAGCCGCTACGGCCTCCTGCACGGGCTTTACCTTATCCTCCGGGAGCAGAAGCCGCTGTGG
TGGCCGATGGCGGTGACGCTGGCGTGCTGCGCCGTCGGCGGTGGCACCTATCCCGCCCTCGCCATACTCTTCTCC
AAGACCATGGACGCCTTCCAGACGGTCAACGTGTCGCGCACCAACTTCTTTGCCCTCATGTTCTTCGTCGTCGCG
CTGGCTAATTTCGTGGCCTACGCTATCGTCGGATGGTTTGCCAACGTGCTCGCGCAGTCCGTCATGAAGTTCTAC
CGCCGCGAAATCTTCAACAACACGCTCCGCCAGGACATGATCTTCTTCGACCACGGCGATAACTCGACGGGCGCC
CTCGTGTCCCGGCTGGCGGCGGAGCCGACGTCGCTGCAGGAGCTGCTGTCGGTCAACGTGGCGCTCATCGTCATC
AACGTCGTCAACCTGCTGGCGTCGTCGGTGCTGGCCATTGCCTACGGCTGGAAGCTTGGCCTGGTGCTGTCGTTC
GGCGCGCTGCCCGTCCTGGTCGGCGCCGGCTACCTGCGGATCCGGCTCGAGTTCAAGTTCGAGAACGACACGGCG
GCGCGGTTTGCGCGCAGCAGCGGCGTGGCGGCCGAGGCTGTCATGGGCATCCGCACCATCTCGTCGCTCGCGCTC
GAGAGGGCCGTCATCGAGCGATACGAGGAGCAGCTGCGCGGCATCGCCGCCCGCGCCATGGGCAGCCTCGGCTGG
AAGATGCTTTTCTACGCCCTCAGCCAGTCCGTCTCCTTCCTCGCTATGGCTCTGGGCTTCTGGTACGGCGGCCGA
CTCGTGTCGACGGGCGAGTACGACAACGGCCAGTTCTACGTCATCTTCATGGCCGTCGTCTACTCGGCCGAGGCG
GCCGCGATGCTGTTCCAGTACACGACAAGCATCACCAAGGCCCGGACCGCGATTAACTACATCTTTGACCTGCGT
CGCCACGTGGAGCTGGTCGACGACGACGAAGACAACGAGGATGAGAATGATGGTGGCGACGATGGCACCGACGGA
GAGAAGAGCGGGCCCCCGGACAAGGGCACCGAGGTCAGGCTCGAGGGAGTCGAGTTCGCATACCCGCTGCGGCCG
CGGCACAAGGTGCTGCGCGGCATCGACCTCGACATGGCGTCGGGAAAGATGGTGGCCCTTGTGGGAGCCTCGGGC
TGCGGCAAGTCGACCGTCATCTCGCTGCTCGAGCGATTCTACGACCCGACGGCCGGTCGCGTCAGCGCCGACGGC
CGCGACGTGCGCTCGCTCGGCCGCCGGCGCTACCGCCGCGACGTGGCCCTGGTCCAGCAGGAGCCGGTGCTGTAC
CAGGGGTCCATCCGCGAGAACGTGGTGCTGGGGCTCGGCGGCCGGCGGGCGAGTCCGGGCCGGGCCGGAGACGCG
GACGCGGACGCGGACGCGGCGACGGAGGTGGCGTGCCGAGCCGCCAATGTGTGGGACTTCATCGCGTCGCTGCCG
CAGGGCCTCGACACGCCGTGCGGCGCGCAGGGCTTATCGCTATCGGGCGGGCAGCGGCAGCGCATCGCCATCGCG
CGGGCGCTGATGCGACGTCCGCGGCTGCTGCTGCTGGACGAGGCGACGAGCGCGCTCGACACCGAGTCGGAGGCG
GTGGTCAAGCGGGCGCTGGACCGCGCCGCCGCGGGCCGCACCACGGTCGCGGTGGCGCACCGGCTCAGCACCGTA
CGCGACGCCGACCTCATCGCCGTCTTCGCCCGCGGCTCCATCGTCGAGCTGGGCACCCACGACGAGCTGGTCGCC
CGCCGCGGCCTGTACTACGACATGGTGCTGAGCCAGTCGCTCGACCGCGAGGCCGCGTAG
Transcript >Hirsu2|2550
ATGGCGACGGGCAAGAAGCAGCAGACCAGCCTTGTGGCCGCCCCGCGGGACGGGAGCGCCTCGCGATCGGGCGGT
TCGACGGACAGGGGCAGTAGCGGCGGCGGCGGCAAGGATGGGAACGGCGGCGGCGACGAGGGAGGCGAGCAAGGC
TCGAGCTTCAAGTACCTGCTGCGCGTCTTCGCCTACAACGACGCCAAGGGCTGGCTCATGAACGCCGTGGCCCTC
GTCTGCATCATCGCCTCCGGCACCGCCCTGCCGCTGATGGACCTCGTCTTCGGCAAGTTCGTCAACACCTTCAAC
GACTTCGCCACAGGCAAGCTGTCGCCCGCCGGCTACCGGGCCGAGGTCTCTCGCTCCTCCTTGTACTTCGTCTAC
ATCTTCATCGGAAAGTTCGTGTTGACGTACATCTGGACGGTCCTCATCAACGTCACGGCCATCCGCACGACCAAG
AAGCTGCGCGTCGACTTCGTCCGCCAGATGCTCCGCCAGGAAGTCTCCTTCTTCGATGCGCCCTCGGCCTCCGTC
TCGGGCCAGATCACGACCAACGGGAACCTGGTCAACAACGGCATCTCGGAGAAGTTGGGCCTGACGGTCCAGGCC
ATGGCCAGCTTCGTCACCGCCTTCGTCGTCGCCTTCGCCGTTCAGTGGAAGCTGACGCTCATCGTCCTGGCCATC
GTCCCCGTCAACGTGGCCGTCACCGTCGCCTGCGTCGTCCGCGACACGATGCTCGAGTACCGCATGTTCGACATC
TACGGCGAGAGCGGCAGCCTGGCCCAGGAGGCCTTTGCCTCCATCCGCAACGCCCACGCCTTCTGGGCCTTCCCC
AGCCTCGTCGCCCGCTTCGGCGCCATCCTCGACCGCGCCGCCCACGTCGGCGACAAGAAGTCGCTCGTCTACGCC
ATCCTCTTCCCCACCGAGTTCTTCTGCGTCATCGCCGGCTACGCCCTGGCCTTTTGGCAGGGCATGCGCATGTAC
GCCTCGGGCGAGATCCAGAACCCAGGCACCGTCGTGACCGTCATCTTCGCCATCCTGGTCGCCGCCCAGGCCCTC
ACCCAGATCGCGCCCCAGACCGTCGCCATCTCCAAGGCCACCGCCGCCGCCCAGGACCTGTTCCGCATCATCGAC
CGCCAGTCCGCCACCGACTCGCTCTCCCAAGACGGCCTCCGCATCTCGTCCTTCCGGGGCGATATCCGGCTGCGC
GGCGTGCGCTTCGCCTATCCCTCCCGACCCGACGTCCCTGTCCTCCACGGCCTCGACCTCGACATCCCGGCTGAC
AAAACGACAGCCTTGGTCGGCTCCAGTGGCTCCGGCAAGAGCACAATCTTCGGCATTCTCGAACGCTGGTACCCC
TTCTCGGCCGGCACTGTCACCCTCGATGGACATGCCCTCGGCGACCTCAACCTGCAGTGGCTCCGCACCAACATC
AGGCTGGTCCAGCAGGAGCCGACTCTGTTCAGCGGCACCATCTTCCAGAACGTCGTCGACGGCCTGACCGGGACC
GACATGGTCCAACTTGCCGACGAGGAGAAGCAAAGGCTCGTGATAGAGGCTTGCAAGGCGTCCTATTCCCATGAC
TTCATTCAAGACTTGCCCAACGGCTACGAGACGTACATTGGTGAACGAGATGCCTCTCTGTCAGGCGGACAGAAG
CAGCGCATCGTCATTGCCCGCAGCATCATTTCCGACCCCAAGGTCCTGCTGCTGGATGAGGCCACCAGCGCGCTC
GACCCTAACGCCGAAAAGATTGTCCAGGCGGCCCTCAACAACGTCGCCAAGGGCCGAACTATGGTTGTCATAGCC
CACCGGCTGTCGACGATCCGCGACGCCGATAATATAGTCGTCATGTCCAAGGGCGAGACCATAGAGAGCGGTACG
CATCAACAGCTGATTGACCACGGGGGCGCATACGCCCGGCTTGTCAAGGCGCAGGATCTGGGACGCGGTGGGGAC
AATGACGTTGAGGAAGAGGACGACGACGACGACGACGAGGAGGGCGATGGAGAGAAGCAGAAGGGCGCCGCGGCC
GCCAACGACCTCGAAGCCGCCCTGACCCGGGCCTCGACGGTGGCGGCATCCCTCGGCGGCGGCGGAGCATCCTGG
GCCGGGCCAGACCGCAGCCGCTACGGCCTCCTGCACGGGCTTTACCTTATCCTCCGGGAGCAGAAGCCGCTGTGG
TGGCCGATGGCGGTGACGCTGGCGTGCTGCGCCGTCGGCGGTGGCACCTATCCCGCCCTCGCCATACTCTTCTCC
AAGACCATGGACGCCTTCCAGACGGTCAACGTGTCGCGCACCAACTTCTTTGCCCTCATGTTCTTCGTCGTCGCG
CTGGCTAATTTCGTGGCCTACGCTATCGTCGGATGGTTTGCCAACGTGCTCGCGCAGTCCGTCATGAAGTTCTAC
CGCCGCGAAATCTTCAACAACACGCTCCGCCAGGACATGATCTTCTTCGACCACGGCGATAACTCGACGGGCGCC
CTCGTGTCCCGGCTGGCGGCGGAGCCGACGTCGCTGCAGGAGCTGCTGTCGGTCAACGTGGCGCTCATCGTCATC
AACGTCGTCAACCTGCTGGCGTCGTCGGTGCTGGCCATTGCCTACGGCTGGAAGCTTGGCCTGGTGCTGTCGTTC
GGCGCGCTGCCCGTCCTGGTCGGCGCCGGCTACCTGCGGATCCGGCTCGAGTTCAAGTTCGAGAACGACACGGCG
GCGCGGTTTGCGCGCAGCAGCGGCGTGGCGGCCGAGGCTGTCATGGGCATCCGCACCATCTCGTCGCTCGCGCTC
GAGAGGGCCGTCATCGAGCGATACGAGGAGCAGCTGCGCGGCATCGCCGCCCGCGCCATGGGCAGCCTCGGCTGG
AAGATGCTTTTCTACGCCCTCAGCCAGTCCGTCTCCTTCCTCGCTATGGCTCTGGGCTTCTGGTACGGCGGCCGA
CTCGTGTCGACGGGCGAGTACGACAACGGCCAGTTCTACGTCATCTTCATGGCCGTCGTCTACTCGGCCGAGGCG
GCCGCGATGCTGTTCCAGTACACGACAAGCATCACCAAGGCCCGGACCGCGATTAACTACATCTTTGACCTGCGT
CGCCACGTGGAGCTGGTCGACGACGACGAAGACAACGAGGATGAGAATGATGGTGGCGACGATGGCACCGACGGA
GAGAAGAGCGGGCCCCCGGACAAGGGCACCGAGGTCAGGCTCGAGGGAGTCGAGTTCGCATACCCGCTGCGGCCG
CGGCACAAGGTGCTGCGCGGCATCGACCTCGACATGGCGTCGGGAAAGATGGTGGCCCTTGTGGGAGCCTCGGGC
TGCGGCAAGTCGACCGTCATCTCGCTGCTCGAGCGATTCTACGACCCGACGGCCGGTCGCGTCAGCGCCGACGGC
CGCGACGTGCGCTCGCTCGGCCGCCGGCGCTACCGCCGCGACGTGGCCCTGGTCCAGCAGGAGCCGGTGCTGTAC
CAGGGGTCCATCCGCGAGAACGTGGTGCTGGGGCTCGGCGGCCGGCGGGCGAGTCCGGGCCGGGCCGGAGACGCG
GACGCGGACGCGGACGCGGCGACGGAGGTGGCGTGCCGAGCCGCCAATGTGTGGGACTTCATCGCGTCGCTGCCG
CAGGGCCTCGACACGCCGTGCGGCGCGCAGGGCTTATCGCTATCGGGCGGGCAGCGGCAGCGCATCGCCATCGCG
CGGGCGCTGATGCGACGTCCGCGGCTGCTGCTGCTGGACGAGGCGACGAGCGCGCTCGACACCGAGTCGGAGGCG
GTGGTCAAGCGGGCGCTGGACCGCGCCGCCGCGGGCCGCACCACGGTCGCGGTGGCGCACCGGCTCAGCACCGTA
CGCGACGCCGACCTCATCGCCGTCTTCGCCCGCGGCTCCATCGTCGAGCTGGGCACCCACGACGAGCTGGTCGCC
CGCCGCGGCCTGTACTACGACATGGTGCTGAGCCAGTCGCTCGACCGCGAGGCCGCGTAG
Gene >Hirsu2|2550
ATGGCGACGGGCAAGAAGCAGCAGACCAGCCTTGTGGCCGCCCCGCGGGACGGGAGCGCCTCGCGATCGGGCGGT
TCGACGGACAGGGGCAGTAGCGGCGGCGGCGGCAAGGATGGGAACGGCGGCGGCGACGAGGGAGGCGAGCAAGGC
TCGAGCTTCAAGTACCTGCTGGTGAGTCCGGCCCGTCGTCCGTCGAAAGAGGGCGAGGGAGAAGAAGATACGGAG
AGAGAGAGAAGAAGATGCAGGCGGATGAAGGCGACAAGACGAACCGGAGAGTGCAAAGCTGACTGCTGGCAAAAC
AACAACAACAGCGCGTCTTCGCCTACAACGACGCCAAGGGCTGGCTCATGAACGCCGTGGCCCTCGTCTGCATCA
TCGCCTCCGGCACCGCCCTGCCGCTGATGGACCTCGTCTTCGGCAAGTTCGTCAACACCTTCAACGACTTCGCCA
CAGGCAAGCTGTCGCCCGCCGGCTACCGGGCCGAGGTCTCTCGCTCCTCGTACGCCTCGCTCTTACCCATCCTTC
TGTCTTCTCTCCGTCTCTTCCTGGGCTCCGTACGGGCTCGAGGTCGGGGAATGGAACGCTGACCTCACGAGAACA
GCTTGTACTTCGTCTACATCTTCATCGGAAAGTTCGTGTTGACGTACATCTGGACGGTATGGCCGCTCTTTCCCC
CTCCCTCCCCCTTCTGACTAAACCTCCAACGTCCTCCTCATCGTCCCTCCATCAGCACTTTTTCCGAGCCTCACT
TTCTTCCTCTTCTCTTTTCATTTTGTTCTGCACAATCTCTTTTCTTTCTCTCATGACGTGCCGCTACGTCCATAC
TTTATGATGATGGGCAATTGGCTGAAGATGGACGACATTTCTAACGGCGAGGCGCCTCCTTCTCATCGCAGGTCC
TCATCAACGTCACGGCCATCCGCACGACCAAGAAGCTGCGCGTCGACTTCGTCCGCCAGATGCTCCGCCAGGAAG
TCTCCTTCTTCGATGCGCCCTCGGCCTCCGTCTCGGGCCAGATCACGACCAACGGGAACCTGGTCAACAACGGCA
TCTCGGAGAAGTTGGGCCTGACGGTCCAGGCCATGGCCAGCTTCGTCACCGCCTTCGTCGTCGCCTTCGCCGTTC
AGTGGAAGCTGACGCTCATCGTCCTGGCCATCGTCCCCGTCAACGTGGCCGTCACCGTCGCCTGCGTCGTCCGCG
ACACGATGCTCGAGTACCGCATGTTCGACATCTACGGCGAGAGCGGCAGCCTGGCCCAGGAGGCCTTTGCCTCCA
TCCGCAACGCCCACGCCTTCTGGGCCTTCCCCAGCCTCGTCGCCCGCTTCGGCGCCATCCTCGACCGCGCCGCCC
ACGTCGGCGACAAGAAGTCGCTCGTCTACGCCATCCTCTTCCCCACCGAGTTCTTCTGCGTCATCGCCGGCTACG
CCCTGGCCTTTTGGCAGGGCATGCGCATGTACGCCTCGGGCGAGATCCAGAACCCAGGCACCGTCGTGACGTGAG
TCTGCATTGCTCCCAGAGGGAAAGCCCACGGCTTCGGCCGAGCCACTGACTCACGTCTCTTCCAGCGTCATCTTC
GCCATCCTGGTCGCCGCCCAGGCCCTCACCCAGATCGCGCCCCAGACCGTCGCCATCTCCAAGGCCACCGCCGCC
GCCCAGGACCTGTTCCGCATCATCGACCGCCAGTCCGCCACCGACTCGCTCTCCCAAGACGGCCTCCGCATCTCG
TCCTTCCGGGGCGATATCCGGCTGCGCGGCGTGCGCTTCGCCTATCCCTCCCGACCCGACGTCCCTGTCCTCCAC
GGCCTCGACCTCGACATCCCGGCTGACAAAACGACAGCCTTGGTCGGCTCCAGTGGCTCCGGCAAGAGCACAATC
TTCGGCATTCTCGAACGCTGGTACCCCTTCTCGGCCGGCACTGTCACCCTCGATGGACATGCCCTCGGCGACCTC
AACCTGCAGTGGCTCCGCACCAACATCAGGCTGGTCCAGCAGGTAAGTTGACTCGGCGTCGATAGTCGTCATAGC
AATCAACGAGCTCCTTTGCTCCGGGAACGAGGTTGAGCTGAGCTGATCCCATCACCTCCTCGCAGGAGCCGACTC
TGTTCAGCGGCACCATCTTCCAGAACGTCGTCGACGGCCTGACCGGGACCGACATGGTCCAACTTGCCGACGAGG
AGAAGCAAAGGCTCGTGATAGAGGCTTGCAAGGCGTCCTATTCCCATGACTTCATTCAAGACTTGCCCAACGTAA
GCCTCAGCCGTCCTGCTCCAGTACGAGAGAGATGGCCGTGTTGTGGCCTGTGGACCATTAGAGCAATGACTGACA
GGCTTCTCTTTCCTCACCAGGGCTACGAGACGTACATTGGTGAACGAGATGCCTCTCTGTCAGGCGGACAGAAGC
AGCGCATCGTCATTGCCCGCAGCATCATTTCCGACCCCAAGGTCCTGCTGCTGGATGAGGCCACCAGCGCGCTCG
ACCCTAACGCCGAAAAGATTGTCCAGGCGGCCCTCAACAACGTCGCCAAGGGCCGAACTATGGTTGTCATAGCCC
ACCGGCTGTCGACGATCCGCGACGCCGATAATATAGTCGTCATGTCCAAGGGCGAGACCATAGAGAGCGGTACGC
ATCAACAGCTGATTGACCACGGGGGCGCATACGCCCGGCTTGTCAAGGCGCAGGATCTGGGACGCGGTGGGGACA
ATGACGTTGAGGAAGAGGACGACGACGACGACGACGAGGAGGGCGATGGAGAGAAGCAGAAGGGCGCCGCGGCCG
CCAACGACCTCGAAGCCGCCCTGACCCGGGCCTCGACGGTGGCGGCATCCCTCGGCGGCGGCGGAGCATCCTGGG
CCGGGCCAGACCGCAGCCGCTACGGCCTCCTGCACGGGCTTTACCTTATCCTCCGGGAGCAGAAGCCGCTGTGGT
GGCCGATGGCGGTGACGCTGGCGTGCTGCGCCGTCGGCGGTGGCACCTATCCCGCCCTCGCCATACTCTTCTCCA
AGACCATGGACGCCTTCCAGACGGTCAACGTGTCGCGCACCAACTTCTTTGCCCTCATGTTCTTCGTCGTCGCGC
TGGCTAATTTCGTGGCCTACGCTATCGTCGGATGGTTTGCCAACGTGCTCGCGCAGGTAAGTCGTTTGCCTTTCC
CCTGCAGCCAGCATATCTCTTTGCGTTCTTCCTTTTACGCCTTGGTGTGTGCATCCGATGCGAGACGAGAGGATG
CGGCGAACAGGGGCTGATGCAGGCTGTTTTCCCTCCCCCATAGTCCGTCATGAAGTTCTACCGCCGCGAAATCTT
CAACAACACGCTCCGCCAGGACATGATCTTCTTCGACCACGGCGATAACTCGACGGGCGCCCTCGTGTCCCGGCT
GGCGGCGGAGCCGACGTCGCTGCAGGAGCTGCTGTCGGTCAACGTGGCGCTCATCGTCATCAACGTCGTCAACCT
GCTGGCGTCGTCGGTGCTGGCCATTGCCTACGGCTGGAAGCTTGGCCTGGTGCTGTCGTTCGGCGCGCTGCCCGT
CCTGGTCGGCGCCGGCTACCTGCGGATCCGGCTCGAGTTCAAGTTCGAGAACGACACGGCGGCGCGGTTTGCGCG
CAGCAGCGGCGTGGCGGCCGAGGCTGTCATGGGCATCCGCACCATCTCGTCGCTCGCGCTCGAGAGGGCCGTCAT
CGAGCGATACGAGGAGCAGCTGCGCGGCATCGCCGCCCGCGCCATGGGCAGCCTCGGCTGGAAGATGCTTTTCTA
CGCCCTCAGCCAGTCCGTCTCCTTCCTCGCTATGGCTCTGGGCTTCTGGTACGGCGGCCGACTCGTGTCGACGGG
CGAGTACGACAACGGCCAGTTCTACGTCATCTTCATGGCCGTCGTCTACTCGGCCGAGGCGGCCGCGATGCTGTT
CCAGTACACGACAAGCATCACCAAGGCCCGGACCGCGATTAACTACATCTTTGACCTGCGTCGCCACGTGGAGCT
GGTCGACGACGACGAAGACAACGAGGATGAGAATGATGGTGGCGACGATGGCACCGACGGAGAGAAGAGCGGGCC
CCCGGACAAGGGCACCGAGGTCAGGCTCGAGGGAGTCGAGTTCGCATACCCGCTGCGGCCGCGGCACAAGGTGCT
GCGCGGCATCGACCTCGACATGGCGTCGGGAAAGATGGTGGCCCTTGTGGGAGCCTCGGGCTGCGGCAAGTCGAC
CGTCATCTCGCTGCTCGAGCGATTCTACGACCCGACGGCCGGTCGCGTCAGCGCCGACGGCCGCGACGTGCGCTC
GCTCGGCCGCCGGCGCTACCGCCGCGACGTGGCCCTGGTCCAGCAGGAGCCGGTGCTGTACCAGGGGTCCATCCG
CGAGAACGTGGTGCTGGGGCTCGGCGGCCGGCGGGCGAGTCCGGGCCGGGCCGGAGACGCGGACGCGGACGCGGA
CGCGGCGACGGAGGTGGCGTGCCGAGCCGCCAATGTGTGGGACTTCATCGCGTCGCTGCCGCAGGGCCTCGACAC
GCCGTGCGGCGCGCAGGGCTTATCGCTATCGGGCGGGCAGCGGCAGCGCATCGCCATCGCGCGGGCGCTGATGCG
ACGTCCGCGGCTGCTGCTGCTGGACGAGGCGACGAGCGCGCTCGACACCGAGTCGGAGGCGGTGGTCAAGCGGGC
GCTGGACCGCGCCGCCGCGGGCCGCACCACGGTCGCGGTGGCGCACCGGCTCAGCACCGTACGCGACGCCGACCT
CATCGCCGTCTTCGCCCGCGGCTCCATCGTCGAGCTGGGCACCCACGACGAGCTGGTCGCCCGCCGCGGCCTGTA
CTACGACATGGTGCTGAGCCAGTCGCTCGACCGCGAGGCCGCGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail