Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2547
Gene name
LocationContig_161:5702..6815
Strand-
Gene length (bp)1113
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07950 DUF1691 Protein of unknown function (DUF1691) 7.7E-33 204 320

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q12106|MCP1_YEAST MDM10-complementing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCP1 PE=1 SV=1 16 275 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 126 148 22
3 189 211 22
4 240 262 22
5 294 316 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2547
METPRRLERRDSQQTLISLLQLDPSPIDTPPFAAWTDKELPPLPDDRSDGGASPVKAGSTAGAPGLSSSGGRGAI
FYLTRAQRYSSYAMSVFMSLHLANVSLIPLATRSVAGSETYLLMTREIYQTSLTEPLLVALPVLAHVGSGLALRL
VRRWQNMRRYGGGTPGMYALHRVMQGDVRPDSPGVRLWPPLSYISLSGYVFAVLYSAHVLINRLLPLAVEGDSSN
IGLAYVAHGFARRPGLSLAAYAGLIAAGCGHMVWGAAKWLGMATSTGGWAGKGRGMVDNKTRRQRRRVWMSIHGV
AVAVAALWAAGGLGVVARGGAAQGWVGRVYDDMLATVRL*
Coding >Hirsu2|2547
ATGGAGACGCCCAGGCGTCTCGAGCGCCGTGACTCGCAGCAGACGCTGATTTCGCTGCTGCAGCTCGATCCATCG
CCCATCGACACGCCGCCCTTCGCCGCATGGACGGACAAGGAGCTTCCGCCGCTGCCCGATGACAGGTCGGACGGC
GGCGCAAGCCCCGTCAAGGCCGGCTCGACCGCTGGCGCGCCTGGACTCAGCAGCAGCGGTGGCCGCGGCGCCATC
TTCTACCTGACGCGCGCCCAGCGGTACTCGAGCTACGCCATGTCGGTCTTCATGTCGCTTCACCTCGCCAACGTC
TCCCTCATCCCTCTGGCGACGCGGTCCGTCGCCGGCTCCGAGACGTACCTCCTCATGACGCGTGAGATCTACCAG
ACCTCCCTCACCGAGCCGTTGCTGGTCGCACTCCCCGTCCTGGCGCATGTCGGGTCGGGCCTGGCCCTGCGGCTG
GTGAGGAGGTGGCAGAACATGCGGAGGTACGGGGGAGGCACGCCCGGCATGTACGCGCTGCATCGCGTCATGCAA
GGAGACGTCAGGCCCGACTCTCCAGGCGTCCGGTTGTGGCCGCCGCTGAGCTACATCTCCCTGTCCGGCTACGTC
TTCGCCGTGCTGTACTCGGCGCACGTCTTGATAAACCGGCTCCTGCCGCTGGCCGTCGAGGGCGACAGCTCCAAC
ATTGGTCTGGCCTACGTGGCCCACGGTTTTGCCCGGCGTCCCGGCCTGTCTCTGGCCGCCTATGCGGGGCTCATC
GCCGCGGGCTGCGGCCACATGGTCTGGGGCGCGGCCAAGTGGCTCGGCATGGCCACCTCAACTGGCGGTTGGGCT
GGAAAGGGGAGAGGCATGGTCGACAACAAGACCAGGAGGCAGCGCCGGCGCGTGTGGATGAGCATCCACGGCGTG
GCCGTGGCCGTGGCCGCGCTGTGGGCTGCGGGCGGGCTGGGCGTCGTAGCCCGAGGGGGCGCGGCGCAGGGCTGG
GTCGGCAGAGTCTATGACGATATGCTGGCCACGGTCCGGCTGTGA
Transcript >Hirsu2|2547
ATGGAGACGCCCAGGCGTCTCGAGCGCCGTGACTCGCAGCAGACGCTGATTTCGCTGCTGCAGCTCGATCCATCG
CCCATCGACACGCCGCCCTTCGCCGCATGGACGGACAAGGAGCTTCCGCCGCTGCCCGATGACAGGTCGGACGGC
GGCGCAAGCCCCGTCAAGGCCGGCTCGACCGCTGGCGCGCCTGGACTCAGCAGCAGCGGTGGCCGCGGCGCCATC
TTCTACCTGACGCGCGCCCAGCGGTACTCGAGCTACGCCATGTCGGTCTTCATGTCGCTTCACCTCGCCAACGTC
TCCCTCATCCCTCTGGCGACGCGGTCCGTCGCCGGCTCCGAGACGTACCTCCTCATGACGCGTGAGATCTACCAG
ACCTCCCTCACCGAGCCGTTGCTGGTCGCACTCCCCGTCCTGGCGCATGTCGGGTCGGGCCTGGCCCTGCGGCTG
GTGAGGAGGTGGCAGAACATGCGGAGGTACGGGGGAGGCACGCCCGGCATGTACGCGCTGCATCGCGTCATGCAA
GGAGACGTCAGGCCCGACTCTCCAGGCGTCCGGTTGTGGCCGCCGCTGAGCTACATCTCCCTGTCCGGCTACGTC
TTCGCCGTGCTGTACTCGGCGCACGTCTTGATAAACCGGCTCCTGCCGCTGGCCGTCGAGGGCGACAGCTCCAAC
ATTGGTCTGGCCTACGTGGCCCACGGTTTTGCCCGGCGTCCCGGCCTGTCTCTGGCCGCCTATGCGGGGCTCATC
GCCGCGGGCTGCGGCCACATGGTCTGGGGCGCGGCCAAGTGGCTCGGCATGGCCACCTCAACTGGCGGTTGGGCT
GGAAAGGGGAGAGGCATGGTCGACAACAAGACCAGGAGGCAGCGCCGGCGCGTGTGGATGAGCATCCACGGCGTG
GCCGTGGCCGTGGCCGCGCTGTGGGCTGCGGGCGGGCTGGGCGTCGTAGCCCGAGGGGGCGCGGCGCAGGGCTGG
GTCGGCAGAGTCTATGACGATATGCTGGCCACGGTCCGGCTGTGA
Gene >Hirsu2|2547
ATGGAGACGCCCAGGCGTCTCGAGCGCCGTGACTCGCAGCAGACGCTGATTTCGCTGCTGCAGCTCGATCCATCG
CCCATCGACACGCCGCCCTTCGCCGCATGGACGGACAAGGAGCTTCCGCCGCTGCCCGATGACAGGTCGGACGGC
GGCGCAAGCCCCGTCAAGGCCGGCTCGACCGCTGGCGCGCCTGGACTCAGCAGCAGCGGTGGCCGCGGCGCCATC
TTCTACCGTACGTCGCCCCGAAAGCCCAGCCGTTCCGTAACACGCCAAGCGCGGTGCAGGGCCAGATGAGTGCGG
CTGTAGTGACAAGATAGCACGACAGTGACGCGCGCCCAGCGGTACTCGAGCTACGCCATGTCGGTCTTCATGTCG
CTTCACCTCGCCAACGTCTCCCTCATCCCTCTGGCGACGCGGTCCGTCGCCGGCTCCGAGACGTACCTCCTCATG
ACGCGTGAGATCTACCAGACCTCCCTCACCGAGCCGTTGCTGGTCGCACTCCCCGTCCTGGCGCATGTCGGGTCG
GGCCTGGCCCTGCGGCTGGTGAGGAGGTGGCAGAACATGCGGAGGTACGGGGGAGGCACGCCCGGCATGTACGCG
CTGCATCGCGTCATGCAAGGAGACGTCAGGCCCGACTCTCCAGGCGTCCGGTTGTGGCCGCCGCTGAGCTACATC
TCCCTGTCCGGCTACGTCTTCGCCGTGCTGTACTCGGCGCACGTCTTGATAAACCGGCTCCTGCCGCTGGCCGTC
GAGGGCGACAGCTCCAACATTGGTCTGGCCTACGTGGCCCACGGTTTTGCCCGGCGTCCCGGCCTGTCTCTGGCC
GCCTATGCGGGGCTCATCGCCGCGGGCTGCGGCCACATGGTCTGGGGCGCGGCCAAGTGGCTCGGCATGGCCACC
TCAACTGGCGGTTGGGCTGGAAAGGGGAGAGGCATGGTCGACAACAAGACCAGGAGGCAGCGCCGGCGCGTGTGG
ATGAGCATCCACGGCGTGGCCGTGGCCGTGGCCGCGCTGTGGGCTGCGGGCGGGCTGGGCGTCGTAGCCCGAGGG
GGCGCGGCGCAGGGCTGGGTCGGCAGAGTCTATGACGATATGCTGGCCACGGTCCGGCTGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail