Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2546
Gene name
LocationContig_161:2238..3462
Strand-
Gene length (bp)1224
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04666 Glyco_transf_54 N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region 7.2E-15 73 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q812F8|MGT4B_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Mus musculus GN=Mgat4b PE=2 SV=1 53 229 8.0E-09
sp|Q4R4A8|MGT4C_MACFA Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Macaca fascicularis GN=MGAT4C PE=2 SV=1 77 254 2.0E-08
sp|Q9D306|MGT4C_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Mus musculus GN=Mgat4c PE=2 SV=1 77 254 3.0E-08
sp|Q9UBM8|MGT4C_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Homo sapiens GN=MGAT4C PE=2 SV=2 77 254 3.0E-08
sp|Q6ITT3|MGT4C_PIG Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Sus scrofa GN=MGAT4C PE=2 SV=1 77 254 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q812F8|MGT4B_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Mus musculus GN=Mgat4b PE=2 SV=1 53 229 8.0E-09
sp|Q4R4A8|MGT4C_MACFA Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Macaca fascicularis GN=MGAT4C PE=2 SV=1 77 254 2.0E-08
sp|Q9D306|MGT4C_MOUSE Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Mus musculus GN=Mgat4c PE=2 SV=1 77 254 3.0E-08
sp|Q9UBM8|MGT4C_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Homo sapiens GN=MGAT4C PE=2 SV=2 77 254 3.0E-08
sp|Q6ITT3|MGT4C_PIG Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C OS=Sus scrofa GN=MGAT4C PE=2 SV=1 77 254 1.0E-07
sp|Q9UQ53|MGT4B_HUMAN Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B OS=Homo sapiens GN=MGAT4B PE=1 SV=1 53 229 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2546
MLPSVIQLLLAAVWLLLFRYCQIHSYADPTSYFFDEQRALALEYTAVREREAEDFLEFAATATRNDTGVGVPTSN
RICLGIPSVRREREQFFARTIASLVDSIGAQERQLLYIVVLLADEDPQLNPAYGQQWVDYIADEVLVYADPAGPP
GGSSRYRRLEAKQAALTRDQHMRLDYANLMDACVARDSDYFVLLEDDVMTSRDWLARLRGALAQMAAATGRRDWL
YLRLFHAEMYLGWNAEEWPSYLAHALVVYLAAGTVALLLRRRATGGAPLRLVKAGRLQSRPLMALLRFNFWFCAF
TLLYFKAGRITVGRYGEGVHEMDKYGCCAQGLAFPSRHLQTLSSAFRATERDLPVDSLIEAVADERGLGRWMMVP
SVLQHVGARGSSAAGGSLKTTLNYSFERQHSS*
Coding >Hirsu2|2546
ATGCTCCCGTCCGTGATCCAGCTCTTGCTGGCCGCAGTCTGGCTCTTACTGTTCCGTTACTGCCAGATTCACTCG
TACGCCGATCCGACCTCGTACTTCTTCGACGAACAGCGCGCCTTGGCCCTCGAATACACGGCGGTACGGGAACGG
GAAGCGGAGGATTTCCTCGAATTCGCCGCGACGGCGACTCGGAACGACACGGGCGTCGGCGTGCCGACGTCCAAC
CGCATCTGCCTCGGCATACCGAGCGTCCGGAGAGAGAGGGAGCAGTTCTTCGCGCGGACGATTGCTTCGCTGGTC
GACTCGATAGGCGCCCAAGAGCGACAGCTGCTGTACATCGTCGTCTTGCTGGCGGACGAGGACCCGCAGCTGAAC
CCGGCCTACGGCCAGCAATGGGTCGACTACATCGCCGACGAGGTCTTGGTCTACGCGGACCCGGCAGGCCCGCCG
GGCGGTAGCAGCCGCTATCGTCGGCTCGAGGCCAAGCAGGCGGCGCTGACGCGAGACCAGCACATGCGGCTCGAC
TACGCGAACCTGATGGACGCCTGCGTCGCGCGCGACTCCGACTACTTCGTCCTGCTCGAGGACGACGTCATGACC
TCGAGGGACTGGCTGGCGCGGCTGCGCGGCGCGCTCGCGCAGATGGCCGCCGCGACCGGGCGCAGGGACTGGCTG
TATCTGCGGCTGTTCCACGCCGAGATGTACCTCGGCTGGAACGCGGAGGAGTGGCCGTCGTACCTGGCGCACGCC
CTGGTGGTCTATCTGGCCGCCGGCACCGTGGCGCTGCTCCTGCGGCGGCGGGCGACCGGGGGAGCGCCCTTGCGG
CTCGTCAAGGCCGGCCGGCTGCAGTCGCGGCCGCTGATGGCGCTGCTGCGCTTCAACTTCTGGTTCTGCGCCTTC
ACCCTCCTCTACTTCAAGGCCGGCCGGATCACGGTCGGTCGGTACGGCGAGGGCGTGCACGAGATGGACAAGTAC
GGCTGCTGCGCGCAGGGACTGGCCTTCCCGAGCCGGCACCTGCAGACGCTGAGCTCGGCCTTCCGGGCGACCGAG
CGCGATCTCCCGGTCGACTCGCTGATCGAGGCCGTCGCGGACGAAAGGGGCCTCGGCAGGTGGATGATGGTCCCC
AGCGTGCTGCAGCACGTCGGTGCCAGGGGCTCATCTGCCGCGGGCGGGAGCCTGAAGACGACGCTGAACTACAGC
TTCGAGAGGCAGCATTCGAGCTGA
Transcript >Hirsu2|2546
ATGCTCCCGTCCGTGATCCAGCTCTTGCTGGCCGCAGTCTGGCTCTTACTGTTCCGTTACTGCCAGATTCACTCG
TACGCCGATCCGACCTCGTACTTCTTCGACGAACAGCGCGCCTTGGCCCTCGAATACACGGCGGTACGGGAACGG
GAAGCGGAGGATTTCCTCGAATTCGCCGCGACGGCGACTCGGAACGACACGGGCGTCGGCGTGCCGACGTCCAAC
CGCATCTGCCTCGGCATACCGAGCGTCCGGAGAGAGAGGGAGCAGTTCTTCGCGCGGACGATTGCTTCGCTGGTC
GACTCGATAGGCGCCCAAGAGCGACAGCTGCTGTACATCGTCGTCTTGCTGGCGGACGAGGACCCGCAGCTGAAC
CCGGCCTACGGCCAGCAATGGGTCGACTACATCGCCGACGAGGTCTTGGTCTACGCGGACCCGGCAGGCCCGCCG
GGCGGTAGCAGCCGCTATCGTCGGCTCGAGGCCAAGCAGGCGGCGCTGACGCGAGACCAGCACATGCGGCTCGAC
TACGCGAACCTGATGGACGCCTGCGTCGCGCGCGACTCCGACTACTTCGTCCTGCTCGAGGACGACGTCATGACC
TCGAGGGACTGGCTGGCGCGGCTGCGCGGCGCGCTCGCGCAGATGGCCGCCGCGACCGGGCGCAGGGACTGGCTG
TATCTGCGGCTGTTCCACGCCGAGATGTACCTCGGCTGGAACGCGGAGGAGTGGCCGTCGTACCTGGCGCACGCC
CTGGTGGTCTATCTGGCCGCCGGCACCGTGGCGCTGCTCCTGCGGCGGCGGGCGACCGGGGGAGCGCCCTTGCGG
CTCGTCAAGGCCGGCCGGCTGCAGTCGCGGCCGCTGATGGCGCTGCTGCGCTTCAACTTCTGGTTCTGCGCCTTC
ACCCTCCTCTACTTCAAGGCCGGCCGGATCACGGTCGGTCGGTACGGCGAGGGCGTGCACGAGATGGACAAGTAC
GGCTGCTGCGCGCAGGGACTGGCCTTCCCGAGCCGGCACCTGCAGACGCTGAGCTCGGCCTTCCGGGCGACCGAG
CGCGATCTCCCGGTCGACTCGCTGATCGAGGCCGTCGCGGACGAAAGGGGCCTCGGCAGGTGGATGATGGTCCCC
AGCGTGCTGCAGCACGTCGGTGCCAGGGGCTCATCTGCCGCGGGCGGGAGCCTGAAGACGACGCTGAACTACAGC
TTCGAGAGGCAGCATTCGAGCTGA
Gene >Hirsu2|2546
ATGCTCCCGTCCGTGATCCAGCTCTTGCTGGCCGCAGTCTGGCTCTTACTGTTCCGTTACTGCCAGATTCACTCG
TACGCCGATCCGACCTCGTACTTCTTCGACGAACAGCGCGCCTTGGCCCTCGAATACACGGCGGTACGGGAACGG
GAAGCGGAGGATTTCCTCGAATTCGCCGCGACGGCGACTCGGAACGACACGGGCGTCGGCGTGCCGACGTCCAAC
CGCATCTGCCTCGGCATACCGAGCGTCCGGAGAGAGAGGGAGCAGTTCTTCGCGCGGACGATTGCTTCGCTGGTC
GACTCGATAGGCGCCCAAGAGCGACAGCTGCTGTACATCGTCGTCTTGCTGGCGGACGAGGACCCGCAGCTGAAC
CCGGCCTACGGCCAGCAATGGGTCGACTACATCGCCGACGAGGTCTTGGTCTACGCGGACCCGGCAGGCCCGCCG
GGCGGTAGCAGCCGCTATCGTCGGCTCGAGGCCAAGCAGGCGGCGCTGACGCGAGACCAGCACATGCGGCTCGAC
TACGCGAACCTGATGGACGCCTGCGTCGCGCGCGACTCCGACTACTTCGTCCTGCTCGAGGACGACGTCATGACC
TCGAGGGACTGGCTGGCGCGGCTGCGCGGCGCGCTCGCGCAGATGGCCGCCGCGACCGGGCGCAGGGACTGGCTG
TATCTGCGGCTGTTCCACGCCGAGATGTACCTCGGCTGGAACGCGGAGGAGTGGCCGTCGTACCTGGCGCACGCC
CTGGTGGTCTATCTGGCCGCCGGCACCGTGGCGCTGCTCCTGCGGCGGCGGGCGACCGGGGGAGCGCCCTTGCGG
CTCGTCAAGGCCGGCCGGCTGCAGTCGCGGCCGCTGATGGCGCTGCTGCGCTTCAACTTCTGGTTCTGCGCCTTC
ACCCTCCTCTACTTCAAGGCCGGCCGGATCACGGTCGGTCGGTACGGCGAGGGCGTGCACGAGATGGACAAGTAC
GGCTGCTGCGCGCAGGGACTGGCCTTCCCGAGCCGGCACCTGCAGACGCTGAGCTCGGCCTTCCGGGCGACCGAG
CGCGATCTCCCGGTCGACTCGCTGATCGAGGCCGTCGCGGACGAAAGGGGCCTCGGCAGGTGGATGATGGTCCCC
AGCGTGCTGCAGCACGTCGGTGCCAGGGGCTCATCTGCCGCGGGCGGGAGCCTGAAGACGACGCTGAACTACAGC
TTCGAGAGGCAGCATTCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail