Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2523
Gene name
LocationContig_160:32961..33201
Strand-
Gene length (bp)240
Transcript length (bp)240
Coding sequence length (bp)240
Protein length (aa) 80

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6117 0.4487 0.1204 0.0649 0.3985 0.3363 0.0897 0.1242 0.2452 0.1114

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup761
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4156
Ophiocordyceps australis map64 (Brazil) OphauB2|6585
Ophiocordyceps camponoti-floridani Ophcf2|05186
Ophiocordyceps camponoti-rufipedis Ophun1|2469
Ophiocordyceps kimflemingae Ophio5|3245
Ophiocordyceps subramaniannii Hirsu2|2523 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6359

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2523
LPPPPPPPRPSSSSSAEGSAAEEPLNEGEGGAKAAQAEEAPRPRVRLDKEAVRRFVAAHRISLDKACDAHGFVAA
GGEA*
Coding >Hirsu2|2523
CTGCCGCCGCCGCCCCCGCCGCCGCGGCCGTCATCATCGTCGTCGGCCGAGGGAAGCGCGGCCGAGGAGCCCCTC
AATGAAGGCGAGGGCGGCGCCAAGGCGGCGCAGGCGGAGGAGGCGCCGCGGCCGCGCGTCCGGCTCGACAAGGAG
GCGGTGCGGCGGTTCGTGGCGGCGCACCGCATCAGCCTCGACAAGGCGTGCGACGCGCACGGCTTCGTCGCGGCC
GGGGGGGAGGCGTGA
Transcript >Hirsu2|2523
CTGCCGCCGCCGCCCCCGCCGCCGCGGCCGTCATCATCGTCGTCGGCCGAGGGAAGCGCGGCCGAGGAGCCCCTC
AATGAAGGCGAGGGCGGCGCCAAGGCGGCGCAGGCGGAGGAGGCGCCGCGGCCGCGCGTCCGGCTCGACAAGGAG
GCGGTGCGGCGGTTCGTGGCGGCGCACCGCATCAGCCTCGACAAGGCGTGCGACGCGCACGGCTTCGTCGCGGCC
GGGGGGGAGGCGTGA
Gene >Hirsu2|2523
CTGCCGCCGCCGCCCCCGCCGCCGCGGCCGTCATCATCGTCGTCGGCCGAGGGAAGCGCGGCCGAGGAGCCCCTC
AATGAAGGCGAGGGCGGCGCCAAGGCGGCGCAGGCGGAGGAGGCGCCGCGGCCGCGCGTCCGGCTCGACAAGGAG
GCGGTGCGGCGGTTCGTGGCGGCGCACCGCATCAGCCTCGACAAGGCGTGCGACGCGCACGGCTTCGTCGCGGCC
GGGGGGGAGGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail