Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|2520
Gene name
LocationContig_160:24211..26908
Strand+
Gene length (bp)2697
Transcript length (bp)2454
Coding sequence length (bp)2454
Protein length (aa) 818

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01612 DNA_pol_A_exo1 3'-5' exonuclease 8.8E-39 226 392
PF08066 PMC2NT PMC2NT (NUC016) domain 1.8E-26 19 109
PF00570 HRDC HRDC domain 1.4E-11 453 519

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10146|RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp6 PE=3 SV=2 16 523 1.0E-118
sp|Q12149|RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP6 PE=1 SV=1 18 523 4.0E-100
sp|Q01780|EXOSX_HUMAN Exosome component 10 OS=Homo sapiens GN=EXOSC10 PE=1 SV=2 47 564 2.0E-79
sp|P56960|EXOSX_MOUSE Exosome component 10 OS=Mus musculus GN=Exosc10 PE=1 SV=2 47 524 2.0E-76
sp|Q0WVE8|RP6L1_ARATH Protein RRP6-like 1 OS=Arabidopsis thaliana GN=RRP6L1 PE=2 SV=1 140 523 9.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10146|RRP6_SCHPO Exosome complex exonuclease rrp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp6 PE=3 SV=2 16 523 1.0E-118
sp|Q12149|RRP6_YEAST Exosome complex exonuclease RRP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP6 PE=1 SV=1 18 523 4.0E-100
sp|Q01780|EXOSX_HUMAN Exosome component 10 OS=Homo sapiens GN=EXOSC10 PE=1 SV=2 47 564 2.0E-79
sp|P56960|EXOSX_MOUSE Exosome component 10 OS=Mus musculus GN=Exosc10 PE=1 SV=2 47 524 2.0E-76
sp|Q0WVE8|RP6L1_ARATH Protein RRP6-like 1 OS=Arabidopsis thaliana GN=RRP6L1 PE=2 SV=1 140 523 9.0E-64
sp|A9LLI7|RP6L2_ARATH Protein RRP6-like 2 OS=Arabidopsis thaliana GN=RRP6L2 PE=2 SV=1 78 523 3.0E-61
sp|A9LLI8|RP6L3_ARATH Protein RRP6-like 3 OS=Arabidopsis thaliana GN=RRP6L3 PE=2 SV=1 192 502 2.0E-45
sp|A9H9B7|RND_GLUDA Ribonuclease D OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rnd PE=3 SV=1 225 498 8.0E-16
sp|Q0BVP4|RND_GRABC Ribonuclease D OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rnd PE=3 SV=2 236 551 3.0E-15
sp|A5G127|RND_ACICJ Ribonuclease D OS=Acidiphilium cryptum (strain JF-5) GN=rnd PE=3 SV=1 225 512 2.0E-12
sp|B8EN54|RND_METSB Ribonuclease D OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rnd PE=3 SV=2 227 526 4.0E-11
sp|Q28RA7|RND_JANSC Ribonuclease D OS=Jannaschia sp. (strain CCS1) GN=rnd PE=3 SV=1 246 498 6.0E-11
sp|A7HYE5|RND_PARL1 Ribonuclease D OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rnd PE=3 SV=2 240 515 4.0E-10
sp|Q1QLI8|RND_NITHX Ribonuclease D OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rnd PE=3 SV=2 246 392 1.0E-09
sp|A6V8R6|RND_PSEA7 Ribonuclease D OS=Pseudomonas aeruginosa (strain PA7) GN=rnd PE=3 SV=2 246 503 2.0E-09
sp|Q6G329|RND_BARHE Ribonuclease D OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rnd PE=3 SV=1 237 501 2.0E-09
sp|C6C608|RND_DICDC Ribonuclease D OS=Dickeya dadantii (strain Ech703) GN=rnd PE=3 SV=2 232 501 5.0E-09
sp|C9XUE4|RND_SICTZ Ribonuclease D OS=Siccibacter turicensis (strain DSM 18703 / LMG 23827 / z3032) GN=rnd PE=3 SV=2 244 501 8.0E-09
sp|Q5NPM2|RND_ZYMMO Ribonuclease D OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rnd PE=3 SV=1 240 392 3.0E-08
sp|Q5GZ75|RND_XANOR Ribonuclease D OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rnd PE=3 SV=2 226 498 2.0E-07
sp|D4Z694|RND_SPHJU Ribonuclease D OS=Sphingobium japonicum (strain NBRC 101211 / UT26S) GN=rnd PE=3 SV=2 246 392 3.0E-07
sp|P09155|RND_ECOLI Ribonuclease D OS=Escherichia coli (strain K12) GN=rnd PE=1 SV=1 246 501 7.0E-07
sp|Q6AJF4|RND_DESPS Ribonuclease D OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rnd PE=3 SV=1 246 492 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000176 nuclear exosome (RNase complex) Yes
GO:0006396 RNA processing Yes
GO:0003676 nucleic acid binding Yes
GO:0005622 intracellular Yes
GO:0008408 3'-5' exonuclease activity Yes
GO:0006139 nucleobase-containing compound metabolic process Yes
GO:0006807 nitrogen compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0016070 RNA metabolic process No
GO:0000178 exosome (RNase complex) No
GO:0071704 organic substance metabolic process No
GO:0044428 nuclear part No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0004527 exonuclease activity No
GO:0005575 cellular_component No
GO:0090304 nucleic acid metabolic process No
GO:1905354 exoribonuclease complex No
GO:0009987 cellular process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:1902494 catalytic complex No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044464 cell part No
GO:1901360 organic cyclic compound metabolic process No
GO:0004518 nuclease activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044446 intracellular organelle part No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|2520
MKSPQDFKALQEGIQKSLVSTVKVVNRLGAEDLSFQRTANPDTAEQLDDQASRVLRLSTRLLQSAARACNAKPPK
LEDVEDIDMKWQAVVDVVDSVLEKADTALDEFTGLIKRREPQGAESQASSSKPTKSTGKVIRNANITKPQVHFER
KPDNFPKSPWKPFITKKPHATVALEQSLVTFTGETGALQYKHPYEAEITSIEYPKRLFKVAEPIPPQPGESTSAI
WVDSYQGVLDMLKDLKRAKEIAVDLEHHDFRTYNGLVCLMQVSTREKDWIVDTLQPWRHKLEVLNEAFADPSIVK
VFHGAYMDMVWLQRDLGLYVNGLFDSYFACRALSYPGKSLAFLLSKFVNFNADKQYQLADWRIRPIPPDMMHYAR
SDTHYLLYIYDCLRNELVSASDRSSPDTDLIGRVLQESKELSLSRNEHPDYDEESGQGSRGWYNLILKKADAIAS
SEQFAVFRALWKWRDRTAREVDESPNFVLGTTNVLEIARINPPDVKALHSLVPFSAPLAKARLQEVWDLIRRAKA
RGGPNILHFLAPGSFVSASKPSASVMLPQASAPWSPPQGDVVFKSLSQSRLFGDMPISTRWEAAEQTPGGQDDAL
PFPWQRFVRDSATGGDPGDEVGGEADQEQTLVADAKAKLETSETGVDPMEEDKDEEFTLKRGRKRKSEAVEDEDD
EDSEDEEQTSGVNEEAPEESSELIAVEDDGPKASKKQRKKERKHQEREEREAAKRREERMARKAKKRQEREKGRV
EEGEEEAEAPFDYSKAPSVLHGKREAGGAGREVKKVFDPYAKTADDGLKGARRAPPIRGERSATFKK*
Coding >Hirsu2|2520
ATGAAGTCACCTCAGGACTTCAAGGCCCTGCAGGAAGGCATCCAGAAGTCCCTCGTCTCCACCGTCAAGGTCGTC
AATCGCCTCGGCGCCGAGGACCTGTCCTTCCAGCGCACCGCCAACCCCGACACCGCCGAGCAGCTCGACGACCAG
GCCTCGCGCGTTCTCCGCCTGTCGACGCGCCTGCTGCAGTCCGCCGCTCGAGCTTGCAATGCCAAGCCGCCAAAG
CTGGAGGATGTCGAGGACATCGACATGAAGTGGCAGGCGGTCGTCGATGTCGTCGATTCAGTCCTCGAGAAGGCC
GACACCGCGCTCGACGAGTTTACCGGCCTGATCAAGCGGAGGGAACCTCAAGGCGCCGAATCCCAGGCATCGAGT
TCCAAGCCAACCAAGTCGACGGGCAAGGTCATCAGAAACGCCAACATCACCAAGCCCCAGGTGCACTTCGAGCGC
AAGCCGGATAACTTTCCCAAGTCGCCCTGGAAGCCCTTCATCACGAAGAAGCCACACGCGACGGTTGCCTTGGAG
CAGAGTCTCGTCACGTTCACGGGAGAGACCGGTGCACTCCAATACAAACACCCGTACGAGGCAGAAATCACCAGC
ATAGAATATCCGAAACGCCTCTTCAAAGTTGCCGAGCCGATTCCCCCTCAACCCGGCGAATCAACATCTGCCATA
TGGGTAGATTCTTACCAAGGCGTGCTGGATATGCTCAAGGACTTGAAACGGGCCAAGGAGATTGCTGTGGATCTG
GAACACCACGACTTCAGGACATACAACGGCCTCGTCTGCTTGATGCAAGTCAGCACACGCGAAAAGGACTGGATC
GTCGATACGCTGCAGCCTTGGCGCCACAAGCTCGAGGTCCTCAACGAAGCCTTTGCCGACCCGAGCATTGTCAAG
GTCTTTCACGGCGCCTACATGGATATGGTCTGGCTGCAGCGAGACCTGGGTCTCTACGTGAACGGCCTCTTCGAC
AGCTACTTCGCTTGTCGCGCCCTTTCTTACCCCGGAAAGAGCCTCGCGTTTCTGCTTTCCAAATTTGTCAACTTC
AACGCCGACAAGCAGTATCAGCTGGCCGACTGGAGGATACGGCCGATTCCCCCGGATATGATGCACTATGCTCGG
TCCGACACGCATTATCTTCTCTACATATACGACTGCCTACGCAACGAGCTAGTTTCTGCGTCCGACCGCAGCAGC
CCGGACACCGACCTCATCGGCCGCGTGCTTCAGGAGTCCAAGGAACTATCCCTCTCGCGCAACGAGCACCCGGAC
TACGACGAAGAGTCTGGACAGGGGTCGCGCGGCTGGTACAACCTCATTCTCAAAAAAGCCGACGCCATTGCGAGC
AGCGAGCAGTTCGCCGTGTTCCGGGCACTCTGGAAGTGGAGGGACAGGACGGCGCGTGAAGTGGACGAGAGCCCC
AATTTCGTTCTCGGCACGACCAACGTCCTCGAAATCGCGCGCATCAATCCGCCCGACGTCAAGGCGCTGCACAGC
CTGGTGCCGTTCTCGGCGCCGCTGGCCAAGGCTCGCCTGCAGGAAGTATGGGATCTGATACGCAGGGCAAAAGCA
AGAGGTGGACCCAACATACTTCACTTCCTCGCGCCCGGAAGTTTCGTTTCTGCCTCGAAGCCTAGCGCGTCCGTC
ATGTTGCCCCAGGCCTCAGCACCCTGGTCACCGCCCCAAGGCGACGTCGTGTTCAAAAGCCTGTCGCAATCACGG
CTCTTCGGAGACATGCCCATCAGCACGCGCTGGGAAGCGGCGGAACAGACGCCCGGAGGACAGGACGACGCCCTG
CCCTTCCCGTGGCAAAGGTTTGTACGAGATTCCGCAACAGGAGGCGATCCGGGCGATGAAGTCGGCGGCGAGGCG
GACCAGGAACAAACATTGGTCGCCGATGCCAAGGCGAAGTTGGAGACGTCCGAAACGGGCGTGGATCCCATGGAA
GAGGACAAGGATGAGGAGTTTACCTTGAAGAGGGGCAGGAAACGAAAATCAGAAGCGGTGGAGGACGAAGACGAC
GAGGATTCAGAGGACGAGGAACAGACTTCCGGCGTCAACGAAGAGGCTCCAGAAGAGAGCAGCGAGCTCATCGCC
GTCGAGGACGACGGGCCCAAGGCCTCGAAGAAGCAGCGAAAGAAGGAACGCAAGCATCAGGAGCGAGAGGAACGC
GAGGCGGCAAAACGACGGGAAGAGCGGATGGCACGGAAGGCCAAGAAGCGGCAGGAAAGAGAGAAGGGGCGTGTG
GAGGAGGGCGAGGAGGAGGCGGAGGCTCCGTTCGACTACTCCAAGGCTCCCTCGGTCTTGCACGGGAAACGGGAG
GCGGGCGGGGCGGGGCGGGAGGTGAAGAAGGTCTTTGACCCGTACGCGAAGACGGCGGACGACGGCTTAAAGGGG
GCACGAAGAGCGCCGCCCATACGGGGCGAGAGGAGCGCGACCTTCAAGAAGTGA
Transcript >Hirsu2|2520
ATGAAGTCACCTCAGGACTTCAAGGCCCTGCAGGAAGGCATCCAGAAGTCCCTCGTCTCCACCGTCAAGGTCGTC
AATCGCCTCGGCGCCGAGGACCTGTCCTTCCAGCGCACCGCCAACCCCGACACCGCCGAGCAGCTCGACGACCAG
GCCTCGCGCGTTCTCCGCCTGTCGACGCGCCTGCTGCAGTCCGCCGCTCGAGCTTGCAATGCCAAGCCGCCAAAG
CTGGAGGATGTCGAGGACATCGACATGAAGTGGCAGGCGGTCGTCGATGTCGTCGATTCAGTCCTCGAGAAGGCC
GACACCGCGCTCGACGAGTTTACCGGCCTGATCAAGCGGAGGGAACCTCAAGGCGCCGAATCCCAGGCATCGAGT
TCCAAGCCAACCAAGTCGACGGGCAAGGTCATCAGAAACGCCAACATCACCAAGCCCCAGGTGCACTTCGAGCGC
AAGCCGGATAACTTTCCCAAGTCGCCCTGGAAGCCCTTCATCACGAAGAAGCCACACGCGACGGTTGCCTTGGAG
CAGAGTCTCGTCACGTTCACGGGAGAGACCGGTGCACTCCAATACAAACACCCGTACGAGGCAGAAATCACCAGC
ATAGAATATCCGAAACGCCTCTTCAAAGTTGCCGAGCCGATTCCCCCTCAACCCGGCGAATCAACATCTGCCATA
TGGGTAGATTCTTACCAAGGCGTGCTGGATATGCTCAAGGACTTGAAACGGGCCAAGGAGATTGCTGTGGATCTG
GAACACCACGACTTCAGGACATACAACGGCCTCGTCTGCTTGATGCAAGTCAGCACACGCGAAAAGGACTGGATC
GTCGATACGCTGCAGCCTTGGCGCCACAAGCTCGAGGTCCTCAACGAAGCCTTTGCCGACCCGAGCATTGTCAAG
GTCTTTCACGGCGCCTACATGGATATGGTCTGGCTGCAGCGAGACCTGGGTCTCTACGTGAACGGCCTCTTCGAC
AGCTACTTCGCTTGTCGCGCCCTTTCTTACCCCGGAAAGAGCCTCGCGTTTCTGCTTTCCAAATTTGTCAACTTC
AACGCCGACAAGCAGTATCAGCTGGCCGACTGGAGGATACGGCCGATTCCCCCGGATATGATGCACTATGCTCGG
TCCGACACGCATTATCTTCTCTACATATACGACTGCCTACGCAACGAGCTAGTTTCTGCGTCCGACCGCAGCAGC
CCGGACACCGACCTCATCGGCCGCGTGCTTCAGGAGTCCAAGGAACTATCCCTCTCGCGCAACGAGCACCCGGAC
TACGACGAAGAGTCTGGACAGGGGTCGCGCGGCTGGTACAACCTCATTCTCAAAAAAGCCGACGCCATTGCGAGC
AGCGAGCAGTTCGCCGTGTTCCGGGCACTCTGGAAGTGGAGGGACAGGACGGCGCGTGAAGTGGACGAGAGCCCC
AATTTCGTTCTCGGCACGACCAACGTCCTCGAAATCGCGCGCATCAATCCGCCCGACGTCAAGGCGCTGCACAGC
CTGGTGCCGTTCTCGGCGCCGCTGGCCAAGGCTCGCCTGCAGGAAGTATGGGATCTGATACGCAGGGCAAAAGCA
AGAGGTGGACCCAACATACTTCACTTCCTCGCGCCCGGAAGTTTCGTTTCTGCCTCGAAGCCTAGCGCGTCCGTC
ATGTTGCCCCAGGCCTCAGCACCCTGGTCACCGCCCCAAGGCGACGTCGTGTTCAAAAGCCTGTCGCAATCACGG
CTCTTCGGAGACATGCCCATCAGCACGCGCTGGGAAGCGGCGGAACAGACGCCCGGAGGACAGGACGACGCCCTG
CCCTTCCCGTGGCAAAGGTTTGTACGAGATTCCGCAACAGGAGGCGATCCGGGCGATGAAGTCGGCGGCGAGGCG
GACCAGGAACAAACATTGGTCGCCGATGCCAAGGCGAAGTTGGAGACGTCCGAAACGGGCGTGGATCCCATGGAA
GAGGACAAGGATGAGGAGTTTACCTTGAAGAGGGGCAGGAAACGAAAATCAGAAGCGGTGGAGGACGAAGACGAC
GAGGATTCAGAGGACGAGGAACAGACTTCCGGCGTCAACGAAGAGGCTCCAGAAGAGAGCAGCGAGCTCATCGCC
GTCGAGGACGACGGGCCCAAGGCCTCGAAGAAGCAGCGAAAGAAGGAACGCAAGCATCAGGAGCGAGAGGAACGC
GAGGCGGCAAAACGACGGGAAGAGCGGATGGCACGGAAGGCCAAGAAGCGGCAGGAAAGAGAGAAGGGGCGTGTG
GAGGAGGGCGAGGAGGAGGCGGAGGCTCCGTTCGACTACTCCAAGGCTCCCTCGGTCTTGCACGGGAAACGGGAG
GCGGGCGGGGCGGGGCGGGAGGTGAAGAAGGTCTTTGACCCGTACGCGAAGACGGCGGACGACGGCTTAAAGGGG
GCACGAAGAGCGCCGCCCATACGGGGCGAGAGGAGCGCGACCTTCAAGAAGTGA
Gene >Hirsu2|2520
ATGAAGTCACCTCAGGACTTCAAGGCCCTGCAGGAAGGCATCCAGAAGTCCCTCGTCTCCACCGTCAAGGTCGTC
AATCGCCTCGGCGCCGAGGACCTGTCCTTCCAGCGCACCGCCAACCCCGACACCGCCGAGCAGCTCGACGACCAG
GCCTCGCGCGTTCTCCGCCTGTCGACGCGCCTGCTGCAGTCCGCCGCTCGAGCTTGCAATGCCAAGCCGCCAAAG
CTGGAGGATGTCGAGGACATCGACATGAAGTGGCAGGCGGTCGTCGATGTCGTCGATTCAGTCCTCGAGAAGGCC
GACACCGCGCTCGACGAGTTTACCGGCCTGATCAAGCGGAGGGAACCTCAAGGCGCCGAATCCGTCCGTCTTCTC
CCCCAAGTCGTATATCACCGACGAGTTCGAGTCTGACCTCACGCCAGCAGGCATCGAGTTCCAAGCCAACCAAGT
CGACGGGCAAGGTCATCAGAAACGCCAACATCACCAAGCCCCAGGTGCACTTCGAGCGCAAGCCGGATAACTTTC
CCAAGTCGCCCTGGAAGCCCTTCATCACGAAGAAGCCACACGCGACGGTTGCCTTGGAGCAGAGTCTCGTCACGT
TCACGGGAGAGACCGGTGCACTCCAGTACTTTTGACCCCCCCCCTCCTTAAAAAGAAATTACGCGACCAAGATGC
TGATTGCACGCCCATGATGCAGATACAAACACCCGTACGAGGCAGAAATCACCAGCATAGAATATCCGAAACGCC
TCTTCAAAGTTGCCGAGCCGATTCCCCCTCAACCCGGCGAATCAACATCTGCCATATGGGTAGATTCTTACCAAG
GCGTGCTGGATATGCTCAAGGACTTGAAACGGGCCAAGGAGATTGCTGTGGATCTGGAACACCACGACTTCAGGA
CATACAACGGCCTCGTCTGCTTGATGCAAGTCAGCACACGCGAAAAGGACTGGATCGTCGATACGCTGCAGCCTT
GGCGCCACAAGCTCGAGGTCCTCAACGAAGCCTTTGCCGACCCGAGCATTGTCAAGGTGAGATTCCCCCGAGTTC
TGCCCGTACAACCGCTCACGCCTCGCCATCTCTAGGTCTTTCACGGCGCCTACATGGATATGGTCTGGCTGCAGC
GAGACCTGGGTCTCTACGTGAACGGCCTCTTCGACAGCTACTTCGCTTGTCGCGCCCTTTCTTACCCCGGAAAGA
GCCTCGCGTTTCTGCTTTCCAAATTTGTCAACTTCAACGCCGACAAGCAGTATCAGCTGGCCGACTGGAGGATAC
GGTAAAGGCCCTGTCCCGACTCTGCCACAGCCTCGTCTCAGTCACTGACCGCTCAACAGGCCGATTCCCCCGGAT
ATGATGCACTATGCTCGGTCCGACACGCATTATCTTCTCTACATATACGACTGCCTACGCAACGAGCTAGTTTCT
GCGTCCGACCGCAGCAGCCCGGACACCGACCTCATCGGCCGCGTGCTTCAGGAGTCCAAGGAACTATCCCTCTCG
CGCAACGAGCACCCGGACTACGACGAAGAGTCTGGACAGGGGTCGCGCGGCTGGTACAACCTCATTCTCAAAAAA
GCCGACGCCATTGCGAGCAGCGAGCAGTTCGCCGTGTTCCGGGCACTCTGGAAGTGGAGGGACAGGACGGCGCGT
GAAGTGGACGAGAGCCCCAATTTCGTTCTCGGCACGACCAACGTCCTCGAAATCGCGCGCATCAATCCGCCCGAC
GTCAAGGCGCTGCACAGCCTGGTGCCGTTCTCGGCGCCGCTGGCCAAGGCTCGCCTGCAGGAAGTATGGGATCTG
ATACGCAGGGCAAAAGCAAGAGGTGGACCCAACATACTTCACTTCCTCGCGCCCGGAAGTTTCGTTTCTGCCTCG
AAGCCTAGCGCGTCCGTCATGTTGCCCCAGGCCTCAGCACCCTGGTCACCGCCCCAAGGCGACGTCGTGTTCAAA
AGCCTGTCGCAATCACGGCTCTTCGGAGACATGCCCATCAGCACGCGCTGGGAAGCGGCGGAACAGACGCCCGGA
GGACAGGACGACGCCCTGCCCTTCCCGTGGCAAAGGTTTGTACGAGATTCCGCAACAGGAGGCGATCCGGGCGAT
GAAGTCGGCGGCGAGGCGGACCAGGAACAAACATTGGTCGCCGATGCCAAGGCGAAGTTGGAGACGTCCGAAACG
GGCGTGGATCCCATGGAAGAGGACAAGGATGAGGAGTTTACCTTGAAGAGGGGCAGGAAACGAAAATCAGAAGCG
GTGGAGGACGAAGACGACGAGGATTCAGAGGACGAGGAACAGACTTCCGGCGTCAACGAAGAGGCTCCAGAAGAG
AGCAGCGAGCTCATCGCCGTCGAGGACGACGGGCCCAAGGCCTCGAAGAAGCAGCGAAAGAAGGAACGCAAGCAT
CAGGAGCGAGAGGAACGCGAGGCGGCAAAACGACGGGAAGAGCGGATGGCACGGAAGGCCAAGAAGCGGCAGGAA
AGAGAGAAGGGGCGTGTGGAGGAGGGCGAGGAGGAGGCGGAGGCTCCGTTCGACTACTCCAAGGCTCCCTCGGTC
TTGCACGGGAAACGGGAGGCGGGCGGGGCGGGGCGGGAGGTGAAGAAGGTCTTTGACCCGTACGCGAAGACGGCG
GACGACGGCTTAAAGGGGGCACGAAGAGCGCCGCCCATACGGGGCGAGAGGAGCGCGACCTTCAAGAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail